GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)

 IL31R_HUMAN             Reviewed;         732 AA.
Q8NI17; A6NIF8; Q2TBA1; Q6EBC3; Q6EBC4; Q6EBC5; Q6EBC6; Q6UWL8; Q8WYJ0;
06-FEB-2007, integrated into UniProtKB/Swiss-Prot.
01-OCT-2002, sequence version 1.
12-AUG-2020, entry version 152.
RecName: Full=Interleukin-31 receptor subunit alpha;
Short=IL-31 receptor subunit alpha;
Short=IL-31R subunit alpha;
Short=IL-31R-alpha;
Short=IL-31RA;
AltName: Full=Cytokine receptor-like 3;
AltName: Full=GLM-R;
Short=hGLM-R;
AltName: Full=Gp130-like monocyte receptor;
Short=Gp130-like receptor;
AltName: Full=ZcytoR17;
Flags: Precursor;
Name=IL31RA; Synonyms=CRL3, GPL; ORFNames=UNQ6368/PRO21073/PRO21384;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY,
SUBCELLULAR LOCATION, AND INDUCTION.
PubMed=11877449; DOI=10.1074/jbc.m201140200;
Ghilardi N., Li J., Hongo J.-A., Yi S., Gurney A., De Sauvage F.J.;
"A novel type I cytokine receptor is expressed on monocytes, signals
proliferation, and activates STAT-3 and STAT-5.";
J. Biol. Chem. 277:16831-16836(2002).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5), FUNCTION,
OLIGOMERIZATION, TISSUE SPECIFICITY, AND INDUCTION.
PubMed=15184896; DOI=10.1038/ni1084;
Dillon S.R., Sprecher C., Hammond A., Bilsborough J.,
Rosenfeld-Franklin M., Presnell S.R., Haugen H.S., Maurer M., Harder B.,
Johnston J., Bort S., Mudri S., Kuijper J.L., Bukowski T., Shea P.,
Dong D.L., Dasovich M., Grant F.J., Lockwood L., Levin S.D., LeCiel C.,
Waggie K., Day H., Topouzis S., Kramer J., Kuestner R., Chen Z., Foster D.,
Parrish-Novak J., Gross J.A.;
"Interleukin 31, a cytokine produced by activated T cells, induces
dermatitis in mice.";
Nat. Immunol. 5:752-760(2004).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
Zhang W., Wan T., He L., Yuan Z., Cao X.;
"A novel soluble type 1 cytokine receptor.";
Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 8).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A.,
Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D.,
Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L.,
Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C.,
Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J.,
Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale effort to
identify novel human secreted and transmembrane proteins: a bioinformatics
assessment.";
Genome Res. 13:2265-2270(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15372022; DOI=10.1038/nature02919;
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S.,
Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M.,
She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.,
Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M.,
Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M.,
Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T.,
Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A.,
Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R.,
Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L.,
Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N.,
Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J.,
Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A.,
Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.;
"The DNA sequence and comparative analysis of human chromosome 5.";
Nature 431:268-274(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
PROTEIN SEQUENCE OF 20-34.
PubMed=15340161; DOI=10.1110/ps.04682504;
Zhang Z., Henzel W.J.;
"Signal peptide prediction based on analysis of experimentally verified
cleavage sites.";
Protein Sci. 13:2819-2824(2004).
[8]
ALTERNATIVE SPLICING (ISOFORMS 9; 10; 11 AND 12), FUNCTION, TISSUE
SPECIFICITY, INDUCTION, SUBCELLULAR LOCATION, AND GLYCOSYLATION.
PubMed=14504285; DOI=10.1074/jbc.m307286200;
Diveu C., Lelievre E., Perret D., Lagrue Lak-Hal A.-H., Froger J.,
Guillet C., Chevalier S., Rousseau F., Wesa A., Preisser L., Chabbert M.,
Gauchat J.-F., Galy A., Gascan H., Morel A.;
"GPL, a novel cytokine receptor related to GP130 and leukemia inhibitory
factor receptor.";
J. Biol. Chem. 278:49850-49859(2003).
[9]
FUNCTION, AND MUTAGENESIS OF TYR-639; TYR-670 AND TYR-708.
PubMed=15627637;
Diveu C., Lagrue Lak-Hal A.-H., Froger J., Ravon E., Grimaud L.,
Barbier F., Hermann J., Gascan H., Chevalier S.;
"Predominant expression of the long isoform of GP130-like (GPL) receptor is
required for interleukin-31 signaling.";
Eur. Cytokine Netw. 15:291-302(2004).
[10]
FUNCTION, INTERACTION WITH JAK1 AND STAT3, AND MUTAGENESIS OF TYR-639;
TYR-670 AND TYR-708.
PubMed=15194700; DOI=10.1074/jbc.m401122200;
Dreuw A., Radtke S., Pflanz S., Lippok B.E., Heinrich P.C., Hermanns H.M.;
"Characterization of the signaling capacities of the novel gp130-like
cytokine receptor.";
J. Biol. Chem. 279:36112-36120(2004).
[11]
INDUCTION, AND TISSUE SPECIFICITY.
PubMed=16461143; DOI=10.1016/j.jaci.2005.10.046;
Bilsborough J., Leung D.Y.M., Maurer M., Howell M., Boguniewicz M., Yao L.,
Storey H., LeCiel C., Harder B., Gross J.A.;
"IL-31 is associated with cutaneous lymphocyte antigen-positive skin homing
T cells in patients with atopic dermatitis.";
J. Allergy Clin. Immunol. 117:418-425(2006).
[12]
TISSUE SPECIFICITY, AND INDUCTION.
PubMed=18439099; DOI=10.1089/jir.2007.0057;
Jawa R.S., Chattopadhyay S., Tracy E., Wang Y., Huntoon K., Dayton M.T.,
Baumann H.;
"Regulated expression of the IL-31 receptor in bronchial and alveolar
epithelial cells, pulmonary fibroblasts, and pulmonary macrophages.";
J. Interferon Cytokine Res. 28:207-219(2008).
[13]
TISSUE SPECIFICITY, AND INDUCTION.
PubMed=21261663; DOI=10.1111/j.1398-9995.2011.02545.x;
Kasraie S., Niebuhr M., Baumert K., Werfel T.;
"Functional effects of interleukin 31 in human primary keratinocytes.";
Allergy 66:845-852(2011).
[14]
TISSUE SPECIFICITY.
PubMed=24373353; DOI=10.1016/j.jaci.2013.10.048;
Cevikbas F., Wang X., Akiyama T., Kempkes C., Savinko T., Antal A.,
Kukova G., Buhl T., Ikoma A., Buddenkotte J., Soumelis V., Feld M.,
Alenius H., Dillon S.R., Carstens E., Homey B., Basbaum A., Steinhoff M.;
"A sensory neuron-expressed IL-31 receptor mediates T helper cell-dependent
itch: Involvement of TRPV1 and TRPA1.";
J. Allergy Clin. Immunol. 133:448-460(2014).
[15]
VARIANT PLCA2 PHE-489.
PubMed=19690585; DOI=10.1038/ejhg.2009.135;
Lin M.W., Lee D.D., Liu T.T., Lin Y.F., Chen S.Y., Huang C.C., Weng H.Y.,
Liu Y.F., Tanaka A., Arita K., Lai-Cheong J., Palisson F., Chang Y.T.,
Wong C.K., Matsuura I., McGrath J.A., Tsai S.F.;
"Novel IL31RA gene mutation and ancestral OSMR mutant allele in familial
primary cutaneous amyloidosis.";
Eur. J. Hum. Genet. 18:26-32(2010).
-!- FUNCTION: Associates with OSMR to form the interleukin-31 receptor
which activates STAT3 and to a lower extent STAT1 and STAT5
(PubMed:11877449, PubMed:14504285, PubMed:15627637, PubMed:15194700).
May function in skin immunity (PubMed:15184896). Mediates IL31-induced
itch, probably in a manner dependent on cation channels TRPA1 and TRPV1
(By similarity). Positively regulates numbers and cycling status of
immature subsets of myeloid progenitor cells in bone marrow in vivo and
enhances myeloid progenitor cell survival in vitro (By similarity).
{ECO:0000250|UniProtKB:Q8K5B1, ECO:0000269|PubMed:11877449,
ECO:0000269|PubMed:14504285, ECO:0000269|PubMed:15184896,
ECO:0000269|PubMed:15194700, ECO:0000269|PubMed:15627637}.
-!- SUBUNIT: Heterodimer with OSMR. Interacts with JAK1 and STAT3.
{ECO:0000269|PubMed:15194700}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000305|PubMed:11877449,
ECO:0000305|PubMed:14504285}; Single-pass type I membrane protein
{ECO:0000305|PubMed:11877449, ECO:0000305|PubMed:14504285}. Cell
junction, synapse, presynaptic cell membrane
{ECO:0000250|UniProtKB:Q8K5B1}. Cell projection, axon
{ECO:0000250|UniProtKB:Q8K5B1}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=12;
Name=1;
IsoId=Q8NI17-1; Sequence=Displayed;
Name=2; Synonyms=v3;
IsoId=Q8NI17-2; Sequence=VSP_022799;
Name=3; Synonyms=v4;
IsoId=Q8NI17-3; Sequence=VSP_022800, VSP_022812, VSP_022813;
Name=4; Synonyms=v2;
IsoId=Q8NI17-4; Sequence=VSP_022799, VSP_022801;
Name=5; Synonyms=v1;
IsoId=Q8NI17-5; Sequence=VSP_022799, VSP_022812, VSP_022813;
Name=6;
IsoId=Q8NI17-6; Sequence=VSP_022798;
Name=7;
IsoId=Q8NI17-7; Sequence=VSP_022800, VSP_022802, VSP_022804,
VSP_022805;
Name=8;
IsoId=Q8NI17-8; Sequence=VSP_022799, VSP_022803, VSP_022807;
Name=9; Synonyms=GPL560, short;
IsoId=Q8NI17-9; Sequence=VSP_022800, VSP_022806;
Name=10; Synonyms=GPL610;
IsoId=Q8NI17-10; Sequence=VSP_022800, VSP_022809, VSP_022810;
Name=11; Synonyms=GPL626;
IsoId=Q8NI17-11; Sequence=VSP_022800, VSP_022808, VSP_022811;
Name=12; Synonyms=GPL745, long;
IsoId=Q8NI17-12; Sequence=VSP_022800;
-!- TISSUE SPECIFICITY: Expressed in CD14- and CD56-positive blood cells
(PubMed:11877449). Expressed in macrophages (PubMed:16461143,
PubMed:18439099). Expressed in keratinocytes (PubMed:21261663).
Expressed in a subset of dorsal root ganglia neurons (at protein level)
(PubMed:24373353). Expressed at low levels in testis, ovary, brain,
prostate, placenta, thymus, bone marrow, trachea and skin
(PubMed:15184896, PubMed:11877449, PubMed:14504285). Expressed in
bronchial and alveolar epithelial cells and pulmonary fibroblasts
(PubMed:18439099). Detected in all of the myelomonocytic lineage
(PubMed:14504285). Isoform 6: Expressed at higher levels in lesional
skin compared to healthy skin of atopic dermatitis patients
(PubMed:24373353). {ECO:0000269|PubMed:11877449,
ECO:0000269|PubMed:14504285, ECO:0000269|PubMed:15184896,
ECO:0000269|PubMed:16461143, ECO:0000269|PubMed:18439099,
ECO:0000269|PubMed:21261663, ECO:0000269|PubMed:24373353}.
-!- INDUCTION: Up-regulated in lesional keratinocytes of patients with
atopic dermatitis (PubMed:16461143). Up-regulated by IFNG/IFN-gamma
(PubMed:11877449, PubMed:14504285, PubMed:15184896, PubMed:21261663,
PubMed:18439099). Up-regulated by bacterial lipopolysaccharides (LPS)
(PubMed:11877449, PubMed:15184896, PubMed:14504285). Up-regulated by
triacylated lipoprotein (Pam3Cys) (PubMed:21261663). Up-regulated by
TGFB1/TGF-beta (PubMed:18439099). {ECO:0000269|PubMed:11877449,
ECO:0000269|PubMed:14504285, ECO:0000269|PubMed:15184896,
ECO:0000269|PubMed:16461143, ECO:0000269|PubMed:18439099,
ECO:0000269|PubMed:21261663}.
-!- PTM: N-glycosylated. {ECO:0000269|PubMed:14504285}.
-!- DISEASE: Amyloidosis, primary localized cutaneous, 2 (PLCA2)
[MIM:613955]: A primary amyloidosis characterized by localized
cutaneous amyloid deposition. This condition usually presents with
itching (especially on the lower legs) and visible changes of skin
hyperpigmentation and thickening that may be exacerbated by chronic
scratching and rubbing. Primary localized cutaneous amyloidosis is
often divided into macular and lichen subtypes although many affected
individuals often show both variants coexisting. Lichen amyloidosis
characteristically presents as a pruritic eruption of grouped
hyperkeratotic papules with a predilection for the shins, calves,
ankles and dorsa of feet and thighs. Papules may coalesce to form
hyperkeratotic plaques that can resemble lichen planus, lichen simplex
or nodular prurigo. Macular amyloidosis is characterized by small
pigmented macules that may merge to produce macular hyperpigmentation,
sometimes with a reticulate or rippled pattern. In macular and lichen
amyloidosis, amyloid is deposited in the papillary dermis in
association with grouped colloid bodies, thought to represent
degenerate basal keratinocytes. The amyloid deposits probably reflect a
combination of degenerate keratin filaments, serum amyloid P component,
and deposition of immunoglobulins. {ECO:0000269|PubMed:19690585}.
Note=The disease is caused by mutations affecting the gene represented
in this entry.
-!- MISCELLANEOUS: [Isoform 9]: Major isoform. Dominant negative IL31
receptor. {ECO:0000305}.
-!- MISCELLANEOUS: [Isoform 12]: Major isoform. Functional IL31 receptor.
{ECO:0000305}.
-!- SIMILARITY: Belongs to the type I cytokine receptor family. Type 2
subfamily. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAS86444.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};
Sequence=AAS86445.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AF486620; AAM27958.1; -; mRNA.
EMBL; AY499339; AAS86444.1; ALT_INIT; mRNA.
EMBL; AY499340; AAS86445.1; ALT_INIT; mRNA.
EMBL; AY499341; AAS86446.1; -; mRNA.
EMBL; AY499342; AAS86447.1; -; mRNA.
EMBL; AF106913; AAL36452.1; -; mRNA.
EMBL; AY358117; AAQ88484.1; -; mRNA.
EMBL; AY358740; AAQ89100.1; -; mRNA.
EMBL; AC008914; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC110490; AAI10491.1; -; mRNA.
CCDS; CCDS3970.2; -. [Q8NI17-2]
CCDS; CCDS56365.1; -. [Q8NI17-5]
CCDS; CCDS56366.1; -. [Q8NI17-3]
CCDS; CCDS56367.1; -. [Q8NI17-6]
CCDS; CCDS75244.1; -. [Q8NI17-8]
CCDS; CCDS75245.1; -. [Q8NI17-12]
RefSeq; NP_001229565.1; NM_001242636.1. [Q8NI17-12]
RefSeq; NP_001229566.1; NM_001242637.1. [Q8NI17-5]
RefSeq; NP_001229567.1; NM_001242638.1. [Q8NI17-3]
RefSeq; NP_001229568.1; NM_001242639.1. [Q8NI17-6]
RefSeq; NP_001284499.1; NM_001297570.1. [Q8NI17-8]
RefSeq; NP_001284501.1; NM_001297572.1.
RefSeq; NP_620586.3; NM_139017.5. [Q8NI17-2]
RefSeq; XP_011541444.1; XM_011543142.2. [Q8NI17-1]
RefSeq; XP_011541445.1; XM_011543143.2. [Q8NI17-3]
RefSeq; XP_011541446.1; XM_011543144.2. [Q8NI17-6]
SMR; Q8NI17; -.
BioGRID; 126357; 26.
IntAct; Q8NI17; 24.
STRING; 9606.ENSP00000415900; -.
GuidetoPHARMACOLOGY; 1710; -.
GlyGen; Q8NI17; 10 sites.
iPTMnet; Q8NI17; -.
PhosphoSitePlus; Q8NI17; -.
BioMuta; IL31RA; -.
DMDM; 74730327; -.
MassIVE; Q8NI17; -.
MaxQB; Q8NI17; -.
PaxDb; Q8NI17; -.
PeptideAtlas; Q8NI17; -.
PRIDE; Q8NI17; -.
ProteomicsDB; 73801; -. [Q8NI17-1]
ProteomicsDB; 73802; -. [Q8NI17-10]
ProteomicsDB; 73803; -. [Q8NI17-11]
ProteomicsDB; 73804; -. [Q8NI17-12]
ProteomicsDB; 73805; -. [Q8NI17-2]
ProteomicsDB; 73806; -. [Q8NI17-3]
ProteomicsDB; 73807; -. [Q8NI17-4]
ProteomicsDB; 73808; -. [Q8NI17-5]
ProteomicsDB; 73809; -. [Q8NI17-6]
ProteomicsDB; 73810; -. [Q8NI17-7]
ProteomicsDB; 73811; -. [Q8NI17-8]
ProteomicsDB; 73812; -. [Q8NI17-9]
ABCD; Q8NI17; 1 sequenced antibody.
Antibodypedia; 23449; 265 antibodies.
Ensembl; ENST00000297015; ENSP00000297015; ENSG00000164509. [Q8NI17-12]
Ensembl; ENST00000354961; ENSP00000347047; ENSG00000164509. [Q8NI17-3]
Ensembl; ENST00000359040; ENSP00000351935; ENSG00000164509. [Q8NI17-5]
Ensembl; ENST00000396836; ENSP00000380048; ENSG00000164509. [Q8NI17-8]
Ensembl; ENST00000490985; ENSP00000427533; ENSG00000164509. [Q8NI17-6]
Ensembl; ENST00000652347; ENSP00000498630; ENSG00000164509. [Q8NI17-2]
GeneID; 133396; -.
KEGG; hsa:133396; -.
UCSC; uc003jqk.3; human. [Q8NI17-1]
CTD; 133396; -.
DisGeNET; 133396; -.
EuPathDB; HostDB:ENSG00000164509.13; -.
GeneCards; IL31RA; -.
HGNC; HGNC:18969; IL31RA.
HPA; ENSG00000164509; Tissue enhanced (brain, tongue).
MalaCards; IL31RA; -.
MIM; 609510; gene.
MIM; 613955; phenotype.
neXtProt; NX_Q8NI17; -.
OpenTargets; ENSG00000164509; -.
Orphanet; 353220; Familial primary localized cutaneous amyloidosis.
PharmGKB; PA134952624; -.
eggNOG; ENOG502QVZY; Eukaryota.
GeneTree; ENSGT00940000155603; -.
HOGENOM; CLU_017990_2_0_1; -.
InParanoid; Q8NI17; -.
KO; K22630; -.
OMA; ILQYDLE; -.
PhylomeDB; Q8NI17; -.
TreeFam; TF338122; -.
PathwayCommons; Q8NI17; -.
Reactome; R-HSA-6788467; IL-6-type cytokine receptor ligand interactions.
SignaLink; Q8NI17; -.
SIGNOR; Q8NI17; -.
BioGRID-ORCS; 133396; 8 hits in 873 CRISPR screens.
ChiTaRS; IL31RA; human.
GeneWiki; IL31RA; -.
GenomeRNAi; 133396; -.
Pharos; Q8NI17; Tbio.
PRO; PR:Q8NI17; -.
Proteomes; UP000005640; Chromosome 5.
RNAct; Q8NI17; protein.
Bgee; ENSG00000164509; Expressed in thoracic aorta and 102 other tissues.
ExpressionAtlas; Q8NI17; baseline and differential.
Genevisible; Q8NI17; HS.
GO; GO:0030424; C:axon; IEA:UniProtKB-SubCell.
GO; GO:0009897; C:external side of plasma membrane; IBA:GO_Central.
GO; GO:0016021; C:integral component of membrane; NAS:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0042734; C:presynaptic membrane; IEA:UniProtKB-SubCell.
GO; GO:0043235; C:receptor complex; IBA:GO_Central.
GO; GO:0019955; F:cytokine binding; IBA:GO_Central.
GO; GO:0004896; F:cytokine receptor activity; IBA:GO_Central.
GO; GO:0019901; F:protein kinase binding; NAS:UniProtKB.
GO; GO:0003713; F:transcription coactivator activity; NAS:UniProtKB.
GO; GO:0002438; P:acute inflammatory response to antigenic stimulus; IEA:Ensembl.
GO; GO:0019221; P:cytokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0006952; P:defense response; NAS:UniProtKB.
GO; GO:0098542; P:defense response to other organism; IEA:Ensembl.
GO; GO:0002067; P:glandular epithelial cell differentiation; IEA:Ensembl.
GO; GO:0042592; P:homeostatic process; NAS:UniProtKB.
GO; GO:0030225; P:macrophage differentiation; NAS:UniProtKB.
GO; GO:0000165; P:MAPK cascade; NAS:UniProtKB.
GO; GO:0030224; P:monocyte differentiation; IEP:UniProtKB.
GO; GO:0043066; P:negative regulation of apoptotic process; NAS:UniProtKB.
GO; GO:0043031; P:negative regulation of macrophage activation; NAS:UniProtKB.
GO; GO:0008284; P:positive regulation of cell population proliferation; IDA:UniProtKB.
GO; GO:0045893; P:positive regulation of transcription, DNA-templated; NAS:UniProtKB.
GO; GO:0042531; P:positive regulation of tyrosine phosphorylation of STAT protein; IEP:UniProtKB.
GO; GO:0007259; P:receptor signaling pathway via JAK-STAT; IEP:UniProtKB.
GO; GO:0035745; P:T-helper 2 cell cytokine production; IEA:Ensembl.
GO; GO:0007169; P:transmembrane receptor protein tyrosine kinase signaling pathway; NAS:UniProtKB.
CDD; cd00063; FN3; 2.
Gene3D; 2.60.40.10; -; 5.
InterPro; IPR003961; FN3_dom.
InterPro; IPR036116; FN3_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR015321; TypeI_recpt_CBD.
Pfam; PF00041; fn3; 2.
Pfam; PF09240; IL6Ra-bind; 1.
SMART; SM00060; FN3; 4.
SUPFAM; SSF49265; SSF49265; 3.
PROSITE; PS50853; FN3; 3.
1: Evidence at protein level;
Alternative splicing; Amyloidosis; Cell junction; Cell membrane;
Cell projection; Direct protein sequencing; Disease mutation; Glycoprotein;
Immunity; Membrane; Polymorphism; Receptor; Reference proteome; Repeat;
Signal; Synapse; Transmembrane; Transmembrane helix.
SIGNAL 1..19
/evidence="ECO:0000269|PubMed:15340161"
CHAIN 20..732
/note="Interleukin-31 receptor subunit alpha"
/id="PRO_0000274572"
TOPO_DOM 20..519
/note="Extracellular"
/evidence="ECO:0000255"
TRANSMEM 520..540
/note="Helical"
/evidence="ECO:0000255"
TOPO_DOM 541..732
/note="Cytoplasmic"
/evidence="ECO:0000255"
DOMAIN 24..122
/note="Fibronectin type-III 1"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
DOMAIN 124..225
/note="Fibronectin type-III 2"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
DOMAIN 223..315
/note="Fibronectin type-III 3"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
DOMAIN 319..416
/note="Fibronectin type-III 4"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
DOMAIN 421..515
/note="Fibronectin type-III 5"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
CARBOHYD 37
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 67
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 93
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 166
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 187
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 277
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 283
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 395
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 455
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 504
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
VAR_SEQ 1..110
/note="Missing (in isoform 6)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_022798"
VAR_SEQ 1
/note="M -> MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM (in isoform
2, isoform 4, isoform 5 and isoform 8)"
/evidence="ECO:0000303|PubMed:12975309,
ECO:0000303|PubMed:15184896"
/id="VSP_022799"
VAR_SEQ 1
/note="M -> MKLSPQPSCVNLGM (in isoform 3, isoform 7,
isoform 9, isoform 10, isoform 11 and isoform 12)"
/evidence="ECO:0000303|PubMed:15184896, ECO:0000303|Ref.3"
/id="VSP_022800"
VAR_SEQ 325..732
/note="Missing (in isoform 4)"
/evidence="ECO:0000303|PubMed:15184896"
/id="VSP_022801"
VAR_SEQ 464..469
/note="GGKGFS -> A (in isoform 7)"
/evidence="ECO:0000303|Ref.3"
/id="VSP_022802"
VAR_SEQ 469..550
/note="SKTVNSSILQYGLESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFEI
ILITSLIGGGLLILIILTVAYGLKKPNKLT -> CKHAHSEVEKNPKPQIDAMDRPVVG
MAPPSHCDLQPGMNHLASLNLSENGAKSTHLLGFWGLNESEVTVPERRVLRKWKELL
(in isoform 8)"
/evidence="ECO:0000303|PubMed:12975309"
/id="VSP_022803"
VAR_SEQ 498..501
/note="TSAG -> YSGG (in isoform 7)"
/evidence="ECO:0000303|Ref.3"
/id="VSP_022804"
VAR_SEQ 502..732
/note="Missing (in isoform 7)"
/evidence="ECO:0000303|Ref.3"
/id="VSP_022805"
VAR_SEQ 548..732
/note="Missing (in isoform 9)"
/evidence="ECO:0000305"
/id="VSP_022806"
VAR_SEQ 551..732
/note="Missing (in isoform 8)"
/evidence="ECO:0000303|PubMed:12975309"
/id="VSP_022807"
VAR_SEQ 593..613
/note="LKPCSTPSDKLVIDKLVVNFG -> KGSELGTKLKFKPLISLDCAF (in
isoform 11)"
/evidence="ECO:0000305"
/id="VSP_022808"
VAR_SEQ 593..598
/note="LKPCST -> RARYQA (in isoform 10)"
/evidence="ECO:0000305"
/id="VSP_022809"
VAR_SEQ 599..732
/note="Missing (in isoform 10)"
/evidence="ECO:0000305"
/id="VSP_022810"
VAR_SEQ 614..732
/note="Missing (in isoform 11)"
/evidence="ECO:0000305"
/id="VSP_022811"
VAR_SEQ 639..649
/note="YVTCPFRPDCP -> TRILSSCPTSI (in isoform 3 and isoform
5)"
/evidence="ECO:0000303|PubMed:15184896"
/id="VSP_022812"
VAR_SEQ 650..732
/note="Missing (in isoform 3 and isoform 5)"
/evidence="ECO:0000303|PubMed:15184896"
/id="VSP_022813"
VARIANT 155
/note="D -> N (in dbSNP:rs13184107)"
/id="VAR_030328"
VARIANT 489
/note="S -> F (in PLCA2)"
/evidence="ECO:0000269|PubMed:19690585"
/id="VAR_065809"
VARIANT 497
/note="S -> N (in dbSNP:rs161704)"
/id="VAR_030329"
MUTAGEN 639
/note="Y->A: No effect on STAT1 and STAT3 activation.
Slight decrease; when associated with A-670 and A-708."
/evidence="ECO:0000269|PubMed:15194700,
ECO:0000269|PubMed:15627637"
MUTAGEN 639
/note="Y->F: Abrogates STAT5 activation. Mild effect on
STAT1 activation. No effect on STAT3 activation."
/evidence="ECO:0000269|PubMed:15194700,
ECO:0000269|PubMed:15627637"
MUTAGEN 670
/note="Y->A: No effect on STAT1 and STAT3 activation.
Slight decrease; when associated with A-639 and A-708."
/evidence="ECO:0000269|PubMed:15194700,
ECO:0000269|PubMed:15627637"
MUTAGEN 670
/note="Y->F: No effect on STAT3 and STAT5 activation. Mild
effect on STAT1 activation."
/evidence="ECO:0000269|PubMed:15194700,
ECO:0000269|PubMed:15627637"
MUTAGEN 708
/note="Y->A: No effect on STAT1 and STAT3 activation.
Slight decrease; when associated with A-639 and A-670."
/evidence="ECO:0000269|PubMed:15194700,
ECO:0000269|PubMed:15627637"
MUTAGEN 708
/note="Y->F: Abrogates STAT3 activation. Loss of
interaction with STAT3. Mild effect on STAT1 activation. No
effect on STAT5 activation."
/evidence="ECO:0000269|PubMed:15194700,
ECO:0000269|PubMed:15627637"
SEQUENCE 732 AA; 82954 MW; 30F84BD3DD99A20E CRC64;
MMWTWALWML PSLCKFSLAA LPAKPENISC VYYYRKNLTC TWSPGKETSY TQYTVKRTYA
FGEKHDNCTT NSSTSENRAS CSFFLPRITI PDNYTIEVEA ENGDGVIKSH MTYWRLENIA
KTEPPKIFRV KPVLGIKRMI QIEWIKPELA PVSSDLKYTL RFRTVNSTSW MEVNFAKNRK
DKNQTYNLTG LQPFTEYVIA LRCAVKESKF WSDWSQEKMG MTEEEAPCGL ELWRVLKPAE
ADGRRPVRLL WKKARGAPVL EKTLGYNIWY YPESNTNLTE TMNTTNQQLE LHLGGESFWV
SMISYNSLGK SPVATLRIPA IQEKSFQCIE VMQACVAEDQ LVVKWQSSAL DVNTWMIEWF
PDVDSEPTTL SWESVSQATN WTIQQDKLKP FWCYNISVYP MLHDKVGEPY SIQAYAKEGV
PSEGPETKVE NIGVKTVTIT WKEIPKSERK GIICNYTIFY QAEGGKGFSK TVNSSILQYG
LESLKRKTSY IVQVMASTSA GGTNGTSINF KTLSFSVFEI ILITSLIGGG LLILIILTVA
YGLKKPNKLT HLCWPTVPNP AESSIATWHG DDFKDKLNLK ESDDSVNTED RILKPCSTPS
DKLVIDKLVV NFGNVLQEIF TDEARTGQEN NLGGEKNGYV TCPFRPDCPL GKSFEELPVS
PEIPPRKSQY LRSRMPEGTR PEAKEQLLFS GQSLVPDHLC EEGAPNPYLK NSVTAREFLV
SEKLPEHTKG EV


Related products :

Catalog number Product name Quantity
EIAAB08300 Chicken,Ciliary neurotrophic factor receptor subunit alpha,CNTF receptor subunit alpha,CNTFR,CNTFR-alpha,Gallus gallus,GPA receptor subunit alpha,GPAR-alpha,Growth-promoting activity receptor subunit
U1815h CLIA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
U1815h CLIA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
U2031h CLIA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031h CLIA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E2031h ELISA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E2031h ELISA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031m CLIA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
E1815r ELISA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
E1815m ELISA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
E2031m ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
U1815m CLIA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
E1815m ELISA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
U2031r CLIA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
E2031m ELISA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
U2031r CLIA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
E2031r ELISA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815m CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
U1815r CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
E1815r ELISA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
E2031r ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
U2031m CLIA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
U1815r CLIA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
Pathways :
WP1963: The effect of Glucocorticoids on target gene expression
WP2292: Chemokine signaling pathway
WP566: canonical wnt - zebrafish
WP2272: Pathogenic Escherichia coli infection
WP1614: 1- and 2-Methylnaphthalene degradation
WP1655: Geraniol degradation
WP1566: Citrate cycle (TCA cycle)
WP444: Signaling of Hepatocyte Growth Factor Receptor
WP926: TGF-beta Receptor Signaling Pathway
WP1348: Androgen Receptor Signaling Pathway
WP26: Signal Transduction of S1P Receptor
WP1162: Signaling of Hepatocyte Growth Factor Receptor
WP783: Androgen Receptor Signaling Pathway
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP480: T Cell Receptor Signaling Pathway
WP94: Signaling of Hepatocyte Growth Factor Receptor
WP1014: Androgen receptor signaling pathway
WP23: B Cell Receptor Signaling Pathway
WP57: Signal Transduction of S1P Receptor
WP1046: Signaling of Hepatocyte Growth Factor Receptor
WP1913: Signaling by Insulin receptor
WP810: Signaling of Hepatocyte Growth Factor Receptor
WP878: EPO Receptor Signaling
WP1271: Toll-like receptor signaling pathway
WP1112: EPO Receptor Signaling

Related Genes :
[IL31RA CRL3 GPL UNQ6368/PRO21073/PRO21384] Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)
[IL6ST] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (CDw130) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[OSMR OSMRB] Oncostatin-M-specific receptor subunit beta (Interleukin-31 receptor subunit beta) (IL-31 receptor subunit beta) (IL-31R subunit beta) (IL-31R-beta) (IL-31RB)
[Osmr Osmrb] Oncostatin-M-specific receptor subunit beta (Interleukin-31 receptor subunit beta) (IL-31 receptor subunit beta) (IL-31R subunit beta) (IL-31R-beta) (IL-31RB)
[Il11ra1 Etl2 Il11ra] Interleukin-11 receptor subunit alpha-1 (IL-11 receptor subunit alpha-1) (IL-11R subunit alpha-1) (IL-11R-alpha-1) (IL-11RA1) (Enhancer trap locus homolog 2) (Etl-2) (Novel cytokine receptor 1) (NR-1) (NR1) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]
[IL27RA CRL1 TCCR WSX1 UNQ296/PRO336] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoR1)
[IL6R] Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126) [Cleaved into: Soluble interleukin-6 receptor subunit alpha (sIL6R)]
[IL11RA] Interleukin-11 receptor subunit alpha (IL-11 receptor subunit alpha) (IL-11R subunit alpha) (IL-11R-alpha) (IL-11RA) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]
[Il27ra Tccr Wsx1] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Type I T-cell cytokine receptor) (TCCR) (WSX-1)
[Osmr Osmrb] Oncostatin-M-specific receptor subunit beta (Interleukin-31 receptor subunit beta) (IL-31 receptor subunit beta) (IL-31R subunit beta) (IL-31R-beta) (IL-31RB)
[IFNLR1 IL28RA LICR2] Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il3ra Sut-1] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (Interleukin-3 receptor class II alpha chain) (CD antigen CD123)
[IL12RB1 IL12R IL12RB] Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212)
[IL4R IL4RA 582J2.1] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[IL15RA] Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]
[IL10RA IL10R] Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)
[IL3RA IL3R] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (CD antigen CD123)
[Il12rb2] Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL-12R-beta-2) (IL-12RB2)
[IL12RB2] Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL-12R-beta-2) (IL-12RB2)
[Il11ra1] Interleukin-11 receptor subunit alpha (IL-11 receptor subunit alpha) (IL-11R subunit alpha) (IL-11R-alpha) (IL-11RA) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]
[IL13RA1 IL13R IL13RA] Interleukin-13 receptor subunit alpha-1 (IL-13 receptor subunit alpha-1) (IL-13R subunit alpha-1) (IL-13R-alpha-1) (IL-13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1)
[IL13RA2 IL13R] Interleukin-13 receptor subunit alpha-2 (IL-13 receptor subunit alpha-2) (IL-13R subunit alpha-2) (IL-13R-alpha-2) (IL-13RA2) (Interleukin-13-binding protein) (CD antigen CD213a2)
[IL5RA IL5R] Interleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5R-alpha) (IL-5RA) (CDw125) (CD antigen CD125)
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124)
[IL7R] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CDw127) (CD antigen CD127)
[Il7r] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CD antigen CD127)
[IL1R1 IL1R IL1RA IL1RT1] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]

Bibliography :