GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interleukin-33 (IL-33) (Interleukin-1 family member 11) (IL-1F11) (Nuclear factor from high endothelial venules) (NF-HEV) [Cleaved into: Interleukin-33 (95-270); Interleukin-33 (99-270); Interleukin-33 (109-270)]

 IL33_HUMAN              Reviewed;         270 AA.
O95760; B2R8L1; B4DJ35; B4E1Q9; D3DRI5; E7EAX4; Q2YEJ5;
05-JUL-2005, integrated into UniProtKB/Swiss-Prot.
01-MAY-1999, sequence version 1.
02-JUN-2021, entry version 156.
RecName: Full=Interleukin-33;
Short=IL-33;
AltName: Full=Interleukin-1 family member 11;
Short=IL-1F11;
AltName: Full=Nuclear factor from high endothelial venules;
Short=NF-HEV;
Contains:
RecName: Full=Interleukin-33 (95-270);
Contains:
RecName: Full=Interleukin-33 (99-270);
Contains:
RecName: Full=Interleukin-33 (109-270);
Flags: Precursor;
Name=IL33 {ECO:0000312|HGNC:HGNC:16028}; Synonyms=C9orf26, IL1F11, NFHEV;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, AND TISSUE
SPECIFICITY.
TISSUE=Endothelial cell;
PubMed=12819012; DOI=10.1016/s0002-9440(10)63631-0;
Baekkevold E.S., Roussigne M., Yamanaka T., Johansen F.-E., Jahnsen F.L.,
Amalric F., Brandtzaeg P., Erard M., Haraldsen G., Girard J.-P.;
"Molecular characterization of NF-HEV, a nuclear factor preferentially
expressed in human high endothelial venules.";
Am. J. Pathol. 163:69-79(2003).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=10566975; DOI=10.1097/00004647-199911000-00013;
Onda H., Kasuya H., Takakura K., Hori T., Imaizumi T., Takeuchi T.,
Inoue I., Takeda J.;
"Identification of genes differentially expressed in canine vasospastic
cerebral arteries after subarachnoid hemorrhage.";
J. Cereb. Blood Flow Metab. 19:1279-1288(1999).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, AND PROTEOLYTIC
PROCESSING.
PubMed=16286016; DOI=10.1016/j.immuni.2005.09.015;
Schmitz J., Owyang A., Oldham E., Song Y., Murphy E., McClanahan T.K.,
Zurawski G., Moshrefi M., Qin J., Li X., Gorman D.M., Bazan J.F.,
Kastelein R.A.;
"IL-33, an interleukin-1-like cytokine that signals via the IL-1 receptor-
related protein ST 2 and induces T helper type 2-associated cytokines.";
Immunity 23:479-490(2005).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
PubMed=21454686; DOI=10.1074/jbc.m111.219089;
Hong J., Bae S., Jhun H., Lee S., Choi J., Kang T., Kwak A., Hong K.,
Kim E., Jo S., Kim S.;
"Identification of constitutively active interleukin 33 (IL-33) splice
variant.";
J. Biol. Chem. 286:20078-20086(2011).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
TISSUE=Adrenal gland, and Trachea;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
"Cloning of human full open reading frames in Gateway(TM) system entry
vector (pDONR201).";
Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164053; DOI=10.1038/nature02465;
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L.,
Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R.,
Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S.,
Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K.,
Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y.,
Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C.,
Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E.,
Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M.,
Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J.,
Frankish A., Frankland J.A., French L., Fricker D.G., Garner P.,
Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S.,
Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J.,
Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E.,
McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V.,
Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S.,
Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K.,
Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J.,
Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M.,
West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L.,
Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J.,
Dunham I.;
"DNA sequence and analysis of human chromosome 9.";
Nature 429:369-374(2004).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[10]
PROTEIN SEQUENCE OF 95-121, IDENTIFICATION BY MASS SPECTROMETRY, FUNCTION,
PROTEOLYTIC CLEAVAGE AT PHE-94 AND LEU-108 BY CSTG, AND PROTEOLYTIC
CLEAVAGE AT ILE-98 BY ELANE.
PubMed=22307629; DOI=10.1073/pnas.1115884109;
Lefrancais E., Roga S., Gautier V., Gonzalez-de-Peredo A., Monsarrat B.,
Girard J.P., Cayrol C.;
"IL-33 is processed into mature bioactive forms by neutrophil elastase and
cathepsin G.";
Proc. Natl. Acad. Sci. U.S.A. 109:1673-1678(2012).
[11]
FUNCTION.
PubMed=17853410; DOI=10.1002/eji.200737547;
Komai-Koma M., Xu D., Li Y., McKenzie A.N., McInnes I.B., Liew F.Y.;
"IL-33 is a chemoattractant for human Th2 cells.";
Eur. J. Immunol. 37:2779-2786(2007).
[12]
FUNCTION, SUBCELLULAR LOCATION, AND NUCLEAR TARGETING DOMAIN.
PubMed=17185418; DOI=10.1073/pnas.0606854104;
Carriere V., Roussel L., Ortega N., Lacorre D.A., Americh L., Aguilar L.,
Bouche G., Girard J.P.;
"IL-33, the IL-1-like cytokine ligand for ST2 receptor, is a chromatin-
associated nuclear factor in vivo.";
Proc. Natl. Acad. Sci. U.S.A. 104:282-287(2007).
[13]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=18787100; DOI=10.2353/ajpath.2008.080014;
Kuchler A.M., Pollheimer J., Balogh J., Sponheim J., Manley L.,
Sorensen D.R., De Angelis P.M., Scott H., Haraldsen G.;
"Nuclear interleukin-33 is generally expressed in resting endothelium but
rapidly lost upon angiogenic or proinflammatory activation.";
Am. J. Pathol. 173:1229-1242(2008).
[14]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=18836528; DOI=10.1371/journal.pone.0003331;
Moussion C., Ortega N., Girard J.P.;
"The IL-1-like cytokine IL-33 is constitutively expressed in the nucleus of
endothelial cells and epithelial cells in vivo: a novel 'alarmin'?";
PLoS ONE 3:E3331-E3331(2008).
[15]
PROTEOLYTIC PROCESSING.
PubMed=19596270; DOI=10.1016/j.bbrc.2009.07.018;
Hayakawa M., Hayakawa H., Matsuyama Y., Tamemoto H., Okazaki H.,
Tominaga S.;
"Mature interleukin-33 is produced by calpain-mediated cleavage in vivo.";
Biochem. Biophys. Res. Commun. 387:218-222(2009).
[16]
PROTEOLYTIC PROCESSING.
PubMed=19559631; DOI=10.1016/j.immuni.2009.05.007;
Luthi A.U., Cullen S.P., McNeela E.A., Duriez P.J., Afonina I.S.,
Sheridan C., Brumatti G., Taylor R.C., Kersse K., Vandenabeele P.,
Lavelle E.C., Martin S.J.;
"Suppression of interleukin-33 bioactivity through proteolysis by apoptotic
caspases.";
Immunity 31:84-98(2009).
[17]
PROTEOLYTIC PROCESSING, AND SUBCELLULAR LOCATION.
PubMed=19465481; DOI=10.1074/jbc.m901744200;
Talabot-Ayer D., Lamacchia C., Gabay C., Palmer G.;
"Interleukin-33 is biologically active independently of caspase-1
cleavage.";
J. Biol. Chem. 284:19420-19426(2009).
[18]
PROTEOLYTIC PROCESSING.
PubMed=19439663; DOI=10.1073/pnas.0812690106;
Cayrol C., Girard J.P.;
"The IL-1-like cytokine IL-33 is inactivated after maturation by caspase-
1.";
Proc. Natl. Acad. Sci. U.S.A. 106:9021-9026(2009).
[19]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=21734074; DOI=10.4049/jimmunol.1003080;
Ali S., Mohs A., Thomas M., Klare J., Ross R., Schmitz M.L., Martin M.U.;
"The dual function cytokine IL-33 interacts with the transcription factor
NF-kappaB to dampen NF-kappaB-stimulated gene transcription.";
J. Immunol. 187:1609-1616(2011).
[20]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=22215666; DOI=10.1074/jbc.m111.298703;
Kakkar R., Hei H., Dobner S., Lee R.T.;
"Interleukin 33 as a mechanically responsive cytokine secreted by living
cells.";
J. Biol. Chem. 287:6941-6948(2012).
[21]
INTERACTION WITH H.POLYGYRUS ARI, AND INDUCTION BY H.POLYGYRUS.
PubMed=29045903; DOI=10.1016/j.immuni.2017.09.015;
Osbourn M., Soares D.C., Vacca F., Cohen E.S., Scott I.C., Gregory W.F.,
Smyth D.J., Toivakka M., Kemter A.M., le Bihan T., Wear M., Hoving D.,
Filbey K.J., Hewitson J.P., Henderson H., Gonzalez-Ciscar A., Errington C.,
Vermeren S., Astier A.L., Wallace W.A., Schwarze J., Ivens A.C.,
Maizels R.M., McSorley H.J.;
"HpARI Protein Secreted by a Helminth Parasite Suppresses Interleukin-33.";
Immunity 47:739-751(2017).
[22]
STRUCTURE BY NMR OF 111-270, INTERACTION WITH IL1RL1 AND IL1RAP, AND
SUBUNIT.
PubMed=19836339; DOI=10.1016/j.str.2009.08.009;
Lingel A., Weiss T.M., Niebuhr M., Pan B., Appleton B.A., Wiesmann C.,
Bazan J.F., Fairbrother W.J.;
"Structure of IL-33 and its interaction with the ST2 and IL-1RAcP
receptors--insight into heterotrimeric IL-1 signaling complexes.";
Structure 17:1398-1410(2009).
[23]
SUBCELLULAR LOCATION, AND INTERACTION WITH TMED10.
PubMed=32272059; DOI=10.1016/j.cell.2020.03.031;
Zhang M., Liu L., Lin X., Wang Y., Li Y., Guo Q., Li S., Sun Y., Tao X.,
Zhang D., Lv X., Zheng L., Ge L.;
"A Translocation Pathway for Vesicle-Mediated Unconventional Protein
Secretion.";
Cell 181:637-652(2020).
[24]
X-RAY CRYSTALLOGRAPHY (3.27 ANGSTROMS) OF 112-270 IN COMPLEX WITH
IL1RL1/ST2, AND MUTAGENESIS OF GLU-144; GLU-148; ASP-149; GLU-165 AND
ASP-244.
PubMed=23980170; DOI=10.1073/pnas.1308651110;
Liu X., Hammel M., He Y., Tainer J.A., Jeng U.S., Zhang L., Wang S.,
Wang X.;
"Structural insights into the interaction of IL-33 with its receptors.";
Proc. Natl. Acad. Sci. U.S.A. 110:14918-14923(2013).
-!- FUNCTION: Cytokine that binds to and signals through the IL1RL1/ST2
receptor which in turn activates NF-kappa-B and MAPK signaling pathways
in target cells (PubMed:16286016). Involved in the maturation of Th2
cells inducing the secretion of T-helper type 2-associated cytokines.
Also involved in activation of mast cells, basophils, eosinophils and
natural killer cells. Acts as a chemoattractant for Th2 cells, and may
function as an 'alarmin', that amplifies immune responses during tissue
injury (PubMed:17853410, PubMed:18836528).
{ECO:0000269|PubMed:16286016, ECO:0000269|PubMed:17853410,
ECO:0000269|PubMed:18836528}.
-!- FUNCTION: In quiescent endothelia the uncleaved form is constitutively
and abundantly expressed, and acts as a chromatin-associated nuclear
factor with transcriptional repressor properties, it may sequester
nuclear NF-kappaB/RELA, lowering expression of its targets
(PubMed:21734074). This form is rapidely lost upon angiogenic or
proinflammatory activation (PubMed:18787100).
{ECO:0000269|PubMed:18787100, ECO:0000269|PubMed:21734074}.
-!- SUBUNIT: Forms a 1:1:1 heterotrimeric complex with its primary high-
affinity receptor IL1RL1 and the coreceptor IL1RAP. Interacts with
cargo receptor TMED10; the interaction mediates the translocation from
the cytoplasm into the ERGIC (endoplasmic reticulum-Golgi intermediate
compartment) and thereby secretion (PubMed:32272059).
{ECO:0000269|PubMed:19836339, ECO:0000269|PubMed:23980170,
ECO:0000269|PubMed:32272059}.
-!- SUBUNIT: (Microbial infection) Interacts (in reduced form) with
H.polygyrus ARI. {ECO:0000269|PubMed:29045903}.
-!- INTERACTION:
O95760; P0C0S8: H2AC17; NbExp=3; IntAct=EBI-724057, EBI-1390628;
O95760; Q01638: IL1RL1; NbExp=2; IntAct=EBI-724057, EBI-993762;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:12819012,
ECO:0000269|PubMed:17185418, ECO:0000269|PubMed:18787100,
ECO:0000269|PubMed:18836528, ECO:0000269|PubMed:21734074}. Chromosome
{ECO:0000269|PubMed:17185418}. Cytoplasm {ECO:0000269|PubMed:32272059}.
Cytoplasmic vesicle, secretory vesicle {ECO:0000269|PubMed:22215666}.
Secreted {ECO:0000269|PubMed:19465481}. Note=Associates with
heterochromatin and mitotic chromosomes (PubMed:17185418). The
secretion is dependent on protein unfolding and facilitated by the
cargo receptor TMED10; it results in protein translocation from the
cytoplasm into the ERGIC (endoplasmic reticulum-Golgi intermediate
compartment) followed by vesicle entry and secretion (PubMed:32272059).
{ECO:0000269|PubMed:32272059}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=O95760-1; Sequence=Displayed;
Name=2;
IsoId=O95760-2; Sequence=VSP_042728;
Name=3; Synonyms=spIL-33;
IsoId=O95760-3; Sequence=VSP_044948;
Name=4;
IsoId=O95760-4; Sequence=VSP_045440;
-!- TISSUE SPECIFICITY: Expressed at high level in high endothelial venules
found in tonsils, Peyer patches and mesenteric lymph nodes. Almost
undetectable in placenta. {ECO:0000269|PubMed:12819012}.
-!- INDUCTION: By infection with the parasite H.polygyrus.
{ECO:0000269|PubMed:29045903}.
-!- DOMAIN: The homeodomain-like HTH domain mediates nuclear localization
and heterochromatin association.
-!- PTM: The full-length protein can be released from cells and is able to
signal via the IL1RL1/ST2 receptor. However, proteolytic processing by
CSTG/cathepsin G and ELANE/neutrophil elastase produces C-terminal
peptides that are more active than the unprocessed full length protein.
May also be proteolytically processed by calpains (PubMed:19596270).
Proteolytic cleavage mediated by apoptotic caspases including CASP3 and
CASP7 results in IL33 inactivation (PubMed:19559631). In vitro
proteolytic cleavage by CASP1 was reported (PubMed:16286016) but could
not be confirmed in vivo (PubMed:19465481) suggesting that IL33 is
probably not a direct substrate for that caspase.
{ECO:0000269|PubMed:16286016, ECO:0000269|PubMed:19439663,
ECO:0000269|PubMed:19465481, ECO:0000269|PubMed:19559631,
ECO:0000269|PubMed:19596270, ECO:0000269|PubMed:22307629}.
-!- MISCELLANEOUS: [Isoform 3]: Constitutively active. {ECO:0000305}.
-!- SIMILARITY: Belongs to the IL-1 family. Highly divergent.
{ECO:0000305}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AB024518; BAA75892.1; -; mRNA.
EMBL; AY905581; AAX86998.1; -; mRNA.
EMBL; HQ641439; ADR77828.1; -; mRNA.
EMBL; AK295908; BAG58697.1; -; mRNA.
EMBL; AK303943; BAG64871.1; -; mRNA.
EMBL; AK313414; BAG36208.1; -; mRNA.
EMBL; CR407619; CAG28547.1; -; mRNA.
EMBL; AL353741; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471071; EAW58748.1; -; Genomic_DNA.
EMBL; CH471071; EAW58750.1; -; Genomic_DNA.
EMBL; CH471071; EAW58751.1; -; Genomic_DNA.
EMBL; BC047085; AAH47085.1; -; mRNA.
CCDS; CCDS56563.1; -. [O95760-2]
CCDS; CCDS56564.1; -. [O95760-4]
CCDS; CCDS6468.1; -. [O95760-1]
CCDS; CCDS83341.1; -. [O95760-3]
RefSeq; NP_001186569.1; NM_001199640.1. [O95760-2]
RefSeq; NP_001186570.1; NM_001199641.1. [O95760-4]
RefSeq; NP_001300973.1; NM_001314044.1. [O95760-1]
RefSeq; NP_001300974.1; NM_001314045.1. [O95760-1]
RefSeq; NP_001300975.1; NM_001314046.1.
RefSeq; NP_001300976.1; NM_001314047.1.
RefSeq; NP_001300977.1; NM_001314048.1. [O95760-3]
RefSeq; NP_254274.1; NM_033439.3. [O95760-1]
PDB; 2KLL; NMR; -; A=111-270.
PDB; 4KC3; X-ray; 3.27 A; A=112-270.
PDBsum; 2KLL; -.
PDBsum; 4KC3; -.
BMRB; O95760; -.
SMR; O95760; -.
BioGRID; 124776; 7.
DIP; DIP-37862N; -.
IntAct; O95760; 6.
MINT; O95760; -.
STRING; 9606.ENSP00000370842; -.
iPTMnet; O95760; -.
PhosphoSitePlus; O95760; -.
BioMuta; IL33; -.
MassIVE; O95760; -.
PaxDb; O95760; -.
PeptideAtlas; O95760; -.
PRIDE; O95760; -.
ProteomicsDB; 4342; -.
ProteomicsDB; 51036; -. [O95760-1]
ProteomicsDB; 51037; -. [O95760-2]
ABCD; O95760; 1 sequenced antibody.
Antibodypedia; 3362; 1370 antibodies.
DNASU; 90865; -.
Ensembl; ENST00000381434; ENSP00000370842; ENSG00000137033. [O95760-1]
Ensembl; ENST00000417746; ENSP00000394039; ENSG00000137033. [O95760-4]
Ensembl; ENST00000456383; ENSP00000414238; ENSG00000137033. [O95760-2]
Ensembl; ENST00000611532; ENSP00000478858; ENSG00000137033. [O95760-3]
GeneID; 90865; -.
KEGG; hsa:90865; -.
UCSC; uc011lmh.3; human. [O95760-1]
CTD; 90865; -.
DisGeNET; 90865; -.
GeneCards; IL33; -.
HGNC; HGNC:16028; IL33.
HPA; ENSG00000137033; Low tissue specificity.
MIM; 608678; gene.
neXtProt; NX_O95760; -.
OpenTargets; ENSG00000137033; -.
PharmGKB; PA162392005; -.
VEuPathDB; HostDB:ENSG00000137033.11; -.
eggNOG; ENOG502RW83; Eukaryota.
GeneTree; ENSGT00390000005185; -.
HOGENOM; CLU_1795771_0_0_1; -.
InParanoid; O95760; -.
OMA; HRKSSKC; -.
OrthoDB; 1062809at2759; -.
PhylomeDB; O95760; -.
TreeFam; TF338120; -.
PathwayCommons; O95760; -.
Reactome; R-HSA-1257604; PIP3 activates AKT signaling.
Reactome; R-HSA-5689880; Ub-specific processing proteases.
Reactome; R-HSA-6811558; PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.
Reactome; R-HSA-9014843; Interleukin-33 signaling.
BioGRID-ORCS; 90865; 4 hits in 983 CRISPR screens.
ChiTaRS; IL33; human.
EvolutionaryTrace; O95760; -.
GenomeRNAi; 90865; -.
Pharos; O95760; Tbio.
PRO; PR:O95760; -.
Proteomes; UP000005640; Chromosome 9.
RNAct; O95760; protein.
Bgee; ENSG00000137033; Expressed in left coronary artery and 204 other tissues.
Genevisible; O95760; HS.
GO; GO:0005694; C:chromosome; IEA:UniProtKB-SubCell.
GO; GO:0005737; C:cytoplasm; IDA:CACAO.
GO; GO:0005576; C:extracellular region; TAS:Reactome.
GO; GO:0005615; C:extracellular space; IEA:UniProtKB-KW.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0005634; C:nucleus; IDA:CACAO.
GO; GO:0030133; C:transport vesicle; IEA:UniProtKB-SubCell.
GO; GO:0005125; F:cytokine activity; IDA:BHF-UCL.
GO; GO:0002112; F:interleukin-33 receptor binding; IEA:Ensembl.
GO; GO:0051607; P:defense response to virus; IEA:Ensembl.
GO; GO:0097191; P:extrinsic apoptotic signaling pathway; IEA:Ensembl.
GO; GO:0038172; P:interleukin-33-mediated signaling pathway; ISS:ARUK-UCL.
GO; GO:0002282; P:microglial cell activation involved in immune response; IEA:Ensembl.
GO; GO:0061518; P:microglial cell proliferation; IEA:Ensembl.
GO; GO:0002638; P:negative regulation of immunoglobulin production; IEA:Ensembl.
GO; GO:0032689; P:negative regulation of interferon-gamma production; IEA:Ensembl.
GO; GO:0002686; P:negative regulation of leukocyte migration; IEA:Ensembl.
GO; GO:0120042; P:negative regulation of macrophage proliferation; ISS:ARUK-UCL.
GO; GO:0002826; P:negative regulation of T-helper 1 type immune response; IEA:Ensembl.
GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; IMP:CACAO.
GO; GO:0150145; P:positive regulation of CD80 production; ISS:ARUK-UCL.
GO; GO:0150142; P:positive regulation of CD86 production; ISS:ARUK-UCL.
GO; GO:0010186; P:positive regulation of cellular defense response; ISS:ARUK-UCL.
GO; GO:0032722; P:positive regulation of chemokine production; IDA:BHF-UCL.
GO; GO:0001819; P:positive regulation of cytokine production; IBA:GO_Central.
GO; GO:0010628; P:positive regulation of gene expression; ISS:ARUK-UCL.
GO; GO:0002639; P:positive regulation of immunoglobulin production; IEA:Ensembl.
GO; GO:0050729; P:positive regulation of inflammatory response; ISS:BHF-UCL.
GO; GO:0032736; P:positive regulation of interleukin-13 production; IEA:Ensembl.
GO; GO:0032753; P:positive regulation of interleukin-4 production; IEA:Ensembl.
GO; GO:0032754; P:positive regulation of interleukin-5 production; IEA:Ensembl.
GO; GO:0032755; P:positive regulation of interleukin-6 production; ISS:ARUK-UCL.
GO; GO:0043032; P:positive regulation of macrophage activation; IDA:BHF-UCL.
GO; GO:0045345; P:positive regulation of MHC class I biosynthetic process; IEA:Ensembl.
GO; GO:0045348; P:positive regulation of MHC class II biosynthetic process; IEA:Ensembl.
GO; GO:0150078; P:positive regulation of neuroinflammatory response; TAS:ARUK-UCL.
GO; GO:0051770; P:positive regulation of nitric-oxide synthase biosynthetic process; ISS:ARUK-UCL.
GO; GO:0032436; P:positive regulation of proteasomal ubiquitin-dependent protein catabolic process; IEA:Ensembl.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; ISS:BHF-UCL.
GO; GO:0032760; P:positive regulation of tumor necrosis factor production; ISS:ARUK-UCL.
GO; GO:0002830; P:positive regulation of type 2 immune response; IEA:Ensembl.
GO; GO:0016579; P:protein deubiquitination; TAS:Reactome.
InterPro; IPR026145; IL-33.
PANTHER; PTHR21114; PTHR21114; 1.
Pfam; PF15095; IL33; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Chromosome; Cytokine; Cytoplasm;
Cytoplasmic vesicle; Direct protein sequencing; Nucleus;
Reference proteome; Secreted; Transcription.
CHAIN 1..270
/note="Interleukin-33"
/id="PRO_0000096790"
PROPEP 1..94
/evidence="ECO:0000269|PubMed:22307629"
/id="PRO_0000430083"
CHAIN 95..270
/note="Interleukin-33 (95-270)"
/id="PRO_0000430084"
CHAIN 99..270
/note="Interleukin-33 (99-270)"
/id="PRO_0000430085"
CHAIN 109..270
/note="Interleukin-33 (109-270)"
/id="PRO_0000430086"
REGION 1..65
/note="Homeodomain-like HTH domain"
REGION 66..111
/note="Interaction with RELA"
/evidence="ECO:0000250"
SITE 94..95
/note="Cleavage; by CTSG"
/evidence="ECO:0000269|PubMed:22307629"
SITE 98..99
/note="Cleavage; by ELANE"
/evidence="ECO:0000269|PubMed:22307629"
SITE 108..109
/note="Cleavage; by CTSG"
/evidence="ECO:0000269|PubMed:22307629"
VAR_SEQ 31..157
/note="KSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVL
AACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDE
SYEIYVEDLKKDEKKD -> N (in isoform 4)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_045440"
VAR_SEQ 72..113
/note="Missing (in isoform 3)"
/evidence="ECO:0000303|PubMed:21454686"
/id="VSP_044948"
VAR_SEQ 115..156
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_042728"
VARIANT 263
/note="I -> M (in dbSNP:rs16924241)"
/id="VAR_049576"
MUTAGEN 144
/note="E->K: Decreases affinity for IL1RL1."
/evidence="ECO:0000269|PubMed:23980170"
MUTAGEN 148
/note="E->K: 7-fold decrease in affinity for IL1RL1."
/evidence="ECO:0000269|PubMed:23980170"
MUTAGEN 149
/note="D->K: Almost abolishes binding to IL1RL1."
/evidence="ECO:0000269|PubMed:23980170"
MUTAGEN 165
/note="E->K: 8-fold decrease in affinity for IL1RL1."
/evidence="ECO:0000269|PubMed:23980170"
MUTAGEN 244
/note="D->K: Decreases affinity for IL1RL1."
/evidence="ECO:0000269|PubMed:23980170"
CONFLICT 139
/note="E -> G (in Ref. 5; BAG36208)"
/evidence="ECO:0000305"
STRAND 112..115
/evidence="ECO:0007829|PDB:2KLL"
STRAND 119..127
/evidence="ECO:0007829|PDB:4KC3"
TURN 129..131
/evidence="ECO:0007829|PDB:2KLL"
STRAND 133..138
/evidence="ECO:0007829|PDB:4KC3"
STRAND 140..148
/evidence="ECO:0007829|PDB:4KC3"
STRAND 158..169
/evidence="ECO:0007829|PDB:4KC3"
TURN 170..172
/evidence="ECO:0007829|PDB:2KLL"
STRAND 180..189
/evidence="ECO:0007829|PDB:4KC3"
STRAND 193..197
/evidence="ECO:0007829|PDB:4KC3"
TURN 198..201
/evidence="ECO:0007829|PDB:4KC3"
STRAND 202..206
/evidence="ECO:0007829|PDB:4KC3"
HELIX 214..216
/evidence="ECO:0007829|PDB:4KC3"
STRAND 218..224
/evidence="ECO:0007829|PDB:4KC3"
STRAND 228..235
/evidence="ECO:0007829|PDB:4KC3"
STRAND 238..243
/evidence="ECO:0007829|PDB:4KC3"
STRAND 246..251
/evidence="ECO:0007829|PDB:4KC3"
HELIX 261..263
/evidence="ECO:0007829|PDB:2KLL"
STRAND 265..267
/evidence="ECO:0007829|PDB:4KC3"
SEQUENCE 270 AA; 30759 MW; 7C158069196EF636 CRC64;
MKPKMKYSTN KISTAKWKNT ASKALCFKLG KSQQKAKEVC PMYFMKLRSG LMIKKEACYF
RRETTKRPSL KTGRKHKRHL VLAACQQQST VECFAFGISG VQKYTRALHD SSITGISPIT
EYLASLSTYN DQSITFALED ESYEIYVEDL KKDEKKDKVL LSYYESQHPS NESGDGVDGK
MLMVTLSPTK DFWLHANNKE HSVELHKCEK PLPDQAFFVL HNMHSNCVSF ECKTDPGVFI
GVKDNHLALI KVDSSENLCT ENILFKLSET


Related products :

Catalog number Product name Quantity
E1980h ELISA C9orf26,Homo sapiens,Human,IL1F11,IL-1F11,IL33,IL-33,Interleukin-1 family member 11,Interleukin-33,NFHEV,NF-HEV,Nuclear factor from high endothelial venules 96T
U1980h CLIA C9orf26,Homo sapiens,Human,IL1F11,IL-1F11,IL33,IL-33,Interleukin-1 family member 11,Interleukin-33,NFHEV,NF-HEV,Nuclear factor from high endothelial venules 96T
E1980h ELISA kit C9orf26,Homo sapiens,Human,IL1F11,IL-1F11,IL33,IL-33,Interleukin-1 family member 11,Interleukin-33,NFHEV,NF-HEV,Nuclear factor from high endothelial venules 96T
U1980h CLIA kit C9orf26,Homo sapiens,Human,IL1F11,IL-1F11,IL33,IL-33,Interleukin-1 family member 11,Interleukin-33,NFHEV,NF-HEV,Nuclear factor from high endothelial venules 96T
40-288-23146 Human IL-33 - Interleukin-1 family member 11. IL-1F11. Nuclear factor from high endothelial venules. NF-HEV ELISA_Kits
orb82722 Human IL1 RN protein Recombinant Human Interleukin-1 Receptor Antagonist is a member of the Interleukin-1cytokine family. IL1RN inhibits the activities of Interleukin-1 alpha (IL1A) and Interleukin-1 1 mg
E2205h Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin-36 ga
U2205h CLIA Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin- 96T
E2205h ELISA Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin 96T
18-321-177008 INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6 - POLYCLONAL ANTIBODY TO MOUSE INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6; IL-6; Interleukin HP-1; B-cell hybridoma growth factor Polyclona 0.1 mg
U2205h CLIA kit Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interle 96T
E2205h ELISA kit Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interl 96T
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
E0066h ELISA kit CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 recepto 96T
E0065h ELISA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recept 96T
U0065h CLIA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recepto 96T
E0066h ELISA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor typ 96T
E2205m Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus
U2205m CLIA kit Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
E2205m ELISA kit Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
U2205m CLIA Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
E2205m ELISA Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
U0066h CLIA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type 96T
26-207 IL1RAPL2 is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 0.05 mg
E0066m ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscu 96T
Pathways :
WP1840: Interleukin-3, 5 and GM-CSF signaling
WP2332: Interleukin-11 Signaling Pathway
WP1839: Interleukin-1 signaling
WP1838: Interleukin-1 processing
WP1046: Signaling of Hepatocyte Growth Factor Receptor
WP431: Nuclear receptors in lipid metabolism and toxicity
WP1834: Interactions of the immunoglobulin superfamily (IgSF) member proteins
WP1162: Signaling of Hepatocyte Growth Factor Receptor
WP755: Nuclear receptors in lipid metabolism and toxicity
WP1235: Signaling of Hepatocyte Growth Factor Receptor
WP863: Nuclear receptors in lipid metabolism and toxicity
WP1909: Signal regulatory protein (SIRP) family interactions
WP1995: Effects of nitric oxide
WP139: Nuclear receptors in lipid metabolism and toxicity
WP950: Nuclear Receptors
WP170: Nuclear Receptors
WP313: Signaling of Hepatocyte Growth Factor Receptor
WP1799: Costimulation by the CD28 family
WP1099: Nuclear receptors in lipid metabolism and toxicity
WP509: Nuclear Receptors
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP831: Nuclear Receptors
WP1899: Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs)
WP1983: Splicing factor NOVA regulated synpatic proteins
WP1385: Nuclear Receptors

Related Genes :
[IL33 C9orf26 IL1F11 NFHEV] Interleukin-33 (IL-33) (Interleukin-1 family member 11) (IL-1F11) (Nuclear factor from high endothelial venules) (NF-HEV) [Cleaved into: Interleukin-33 (95-270); Interleukin-33 (99-270); Interleukin-33 (109-270)]
[Il33] Interleukin-33 (IL-33) [Cleaved into: Interleukin-33(102-266); Interleukin-33(109-266)]
[Il1rap] Interleukin-1 receptor accessory protein (IL-1 receptor accessory protein) (IL-1RAcP) (EC 3.2.2.6) (Interleukin-33 receptot beta chain)
[Il33] Interleukin-33 (IL-33)
[IL33] Interleukin-33 (IL-33)
[Il1rl1 Ly84 St2 Ste2] Interleukin-1 receptor-like 1 (EC 3.2.2.6) (Interleukin-33 receptor alpha chain) (Lymphocyte antigen 84) (Protein ST2) (Protein T1)
[Il1r1 Il-1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[ORF1ab orf1ab] 2'-O-methyltransferase (EC 2.7.7.48) (EC 3.4.19.12) (EC 3.4.22.69) (EC 3.6.4.12) (EC 3.6.4.13) (3C-like proteinase) (Growth factor-like peptide) (Guanine-N7 methyltransferase) (Helicase) (Host translation inhibitor nsp1) (Leader protein) (NendoU) (Non-structural protein 10) (Non-structural protein 2) (Non-structural protein 3) (Non-structural protein 4) (Non-structural protein 6) (Non-structural protein 7) (Non-structural protein 8) (Non-structural protein 9) (ORF1ab polyprotein) (Papain-like proteinase) (RNA-directed RNA polymerase) (Replicase polyprotein 1ab) (Uridylate-specific endoribonuclease) (p65 homolog)
[ORF1ab ORF1a orf1ab] 3C-like proteinase (EC 3.4.19.12) (EC 3.4.22.69) (Growth factor-like peptide) (Leader protein) (Non-structural protein 10) (Non-structural protein 2) (Non-structural protein 3) (Non-structural protein 4) (Non-structural protein 6) (Non-structural protein 7) (Non-structural protein 8) (Non-structural protein 9) (Papain-like proteinase) (p65 homolog)
[yaiE ppnP yaiE_1 yaiE_2 A6581_06820 A6592_08565 A6V01_02400 A8C65_08910 A9819_01890 A9P13_20020 A9R57_08485 A9X72_19070 AC067_13660 AC789_1c03900 ACN002_0406 ACN68_10320 ACN81_25005 ACU57_12035 ACU90_20960 AM270_02350 AM333_11080 AM340_00170 AM375_22275 AM446_21575 AM464_18935 AM465_24670 AMK83_08820 AML35_16935 APT94_15240 APU18_24510 APX88_10995 ARC77_21605 AU473_24575 AUQ13_18550 AUS26_08265 AW059_14025 AWB10_19430 AWE53_023695 AWF06_05110 AWF59_002255 AZZ83_000156 B6V57_02070 B7C53_19905 B9N33_08655 B9T59_05995 BANRA_00817 BANRA_00925 BANRA_02015 BANRA_03594 BB545_15535 BE963_16095 BEN53_04105 BER14_23410 BFD68_18150 BFL24_02350 BHF03_17705 BHS81_02405 BHS87_02130 BIQ87_02175 BIU72_03345 BIZ41_26355 BJJ90_20310 BK248_04610 BK292_14635 BK296_16405 BK373_01320 BK375_26975 BK383_14985 BMA87_04900 BMT91_05310 BN17_01951 BOH76_16090 BON63_11530 BON65_18745 BON66_09075 BON69_11595 BON72_15085 BON75_11450 BON76_23825 BON83_20655 BON86_03800 BON87_15370 BON91_23895 BON92_15465 BON94_14845 BON95_06500 BON96_22295 BON98_18895 BTQ04_02855 BTQ06_17790 BUE81_15520 BvCms12BK_04795 BvCms2454_01767 BvCms28BK_00703 BvCms35BK_00554 BvCmsC61A_02990 BvCmsHHP001_01952 BvCmsHHP019_02594 BvCmsHHP019_02735 BvCmsHHP056_01410 BvCmsKKP036_04281 BvCmsKKP061_04019 BvCmsKSNP073_05624 BvCmsKSNP081_00030 BvCmsKSNP120_04274 BvCmsKSP011_04945 BvCmsKSP024_04930 BvCmsKSP045_04772 BvCmsKSP058_04860 BvCmsKSP067_05191 BvCmsKSP076_04759 BvCmsNSP006_01281 BvCmsNSP007_00849 BvCmsNSP047_03416 BvCmsNSP072_00997 BvCmsOUP014_01108 BvCmsSINP011_02573 BvCmsSINP022_02885 BvCmsSIP019_03625 BvCmsSIP024_01003 BvCmsSIP044_01545 BVL39_00880 BW690_06575 BWI89_12535 BWP17_02145 BXT93_00165 BZL31_10725 BZL69_16805 C2M16_02670 C2U48_08110 C3F40_10585 C4K41_08090 C4M78_16865 C5715_13595 C5F72_20070 C5F73_09375 C5N07_12740 C5P01_16305 C5P44_19530 C6669_02755 C6984_01965 C7235_18880 C7B02_04545 C7B06_13385 C7B07_15195 C7B08_06180 C7B18_00985 C9114_16640 C9160_00550 C9162_12650 C9201_03800 C9306_02820 C9E25_04580 C9E63_22465 C9E67_23765 C9Z03_06575 C9Z23_12315 C9Z28_08265 C9Z37_04640 C9Z68_20485 C9Z70_09610 C9Z78_08360 CA593_01185 CCZ17_04120 CDC27_00860 CDL37_09465 CG692_05055 CI641_017850 CI694_14320 CJU64_02110 CO706_24355 COD30_16055 COD46_04855 CQP61_20925 CR538_19495 CR539_06140 CRD98_01665 CRE06_07890 CRM83_13790 CT144_18010 CT146_15735 CUB99_06570 CV83915_01183 CVH05_20630 CWS33_22875 CY655_02075 D0X26_07420 D1912_23295 D2184_11515 D2185_12065 D2188_07740 D3821_12900 D3822_22465 D3C88_28950 D3O91_15305 D3Y67_14350 D4023_06905 D4M06_05545 D4M76_11590 D4U49_03050 D4V08_07680 D5H35_11765 D6004_10480 D6C57_04065 D6D43_08420 D6T60_09300 D6X76_06760 D7K63_09055 D7K66_05505 D7Y10_05925 D7Z75_05315 D8Y65_05290 D9610_20040 D9C99_17255 D9D20_11505 D9D31_21970 D9D43_14830 D9D94_14580 D9E34_09525 D9E49_06955 D9E73_13115 D9E88_02060 D9F32_03890 D9F87_10325 D9G11_17940 D9G42_13940 D9G48_15840 D9G69_10950 D9G95_10030 D9H53_17415 D9H68_03320 D9H70_06445 D9H94_24405 D9I18_05395 D9I20_07245 D9I87_03310 D9I88_07660 D9I97_02265 D9J03_17400 D9J11_02150 D9J44_05830 D9J52_12125 D9J60_08565 D9J61_02635 D9K02_04260 D9K48_11575 D9K54_20845 D9L89_06360 D9X97_05410 D9Z28_01965 DAH18_14975 DAH23_10455 DAH30_15925 DAH34_21345 DAH37_05240 DD762_07680 DEN86_05080 DEN89_14495 DEO04_04545 DEO20_14385 DIV22_26285 DJ503_01820 DL455_04445 DL473_20145 DL530_07575 DL545_19130 DL637_11475 DL705_16435 DL800_03885 DL979_15710 DLU82_01595 DLX40_16565 DM102_12740 DM129_06110 DM155_09525 DM962_06005 DMZ30_04890 DMZ50_06340 DN627_04525 DN660_05650 DN808_18120 DNC98_06510 DND16_02325 DND79_04070 DNI21_04080 DNQ45_00335 DNR41_17405 DOT59_02705 DOY61_02085 DOY67_05265 DP258_05110 DP277_07535 DQF57_07675 DQO13_05500 DQP61_12090 DRW19_06400 DS143_21555 DS732_06920 DS966_18475 DSZ60_03875 DT034_10500 DTL43_07415 DTL90_10740 DTM10_06080 DTM25_13935 DTM45_10960 DTZ20_03380 DU321_19460 DU333_14985 DW236_15815 DWB25_19225 DXT69_08115 DXT71_02970 DXT73_01860 DXX80_018650 E0I42_07410 E0L04_02150 E0L12_02445 E2115_06350 E2119_01725 E2123_04610 E2127_09375 E2128_04435 E2129_13975 E2134_12225 E2135_01410 E2855_00540 E2863_00426 E4K51_12070 E4K53_09880 E4K55_09545 E4K61_11255 E5P24_15620 E5P28_11315 E5S34_07545 E5S38_06765 E5S43_12135 E5S44_09845 E5S56_05125 E5S58_11035 E5S61_09810 E5S62_19990 E8P32_20890 EA174_09235 EA184_12770 EA191_05310 EA206_10815 EA211_00925 EA213_08335 EA214_19270 EA219_17055 EA225_09190 EA233_12800 EA239_15730 EA250_12110 EA433_19520 EA435_05820 EA834_11650 EAI42_35435 EAI46_25725 EAI46_25840 EAI52_02950 EAM59_14455 EAN77_07940 EAX79_06830 EB510_01625 EB515_09345 EB525_RS00545 EBM08_07705 EBP16_12520 EC1094V2_3464 EC3234A_4c00610 EC382_12595 EC95NR1_04612 ECs0441 ECTO124_03817 ECTO6_03708 ED225_07600 ED600_06320 ED611_06650 ED648_16775 ED903_13725 ED944_09580 EEA45_02855 EEP23_01045 EF082_13590 EF173_10565 EG599_13105 EG808_04255 EGT48_21390 EH412_12630 EHD79_03470 EHH55_15815 EHJ36_08465 EI021_16245 EI032_07550 EI041_08145 EIA21_11810 EIZ93_00830 EJC75_24145 EKI52_09170 EL75_3359 EL79_3454 EL80_3408 ELT17_22260 ELT22_04045 ELT23_00125 ELT31_00280 ELT33_03015 ELT48_00735 ELT49_21480 ELT58_21305 ELU82_03335 ELU85_08960 ELU96_05805 ELV00_13055 ELV08_00785 ELV13_00555 ELV15_22680 ELV22_01630 ELV24_16525 ELV28_08410 ELX56_03900 ELX61_20790 ELX68_02065 ELX69_19550 ELX70_07125 ELX76_05850 ELX79_24270 ELX83_01445 ELX96_14305 ELY05_09885 ELY23_04665 ELY24_07180 ELY32_22740 ELY41_15435 ELY48_07355 ELY50_04295 EO241_13835 EPS70_14865 EPS76_10515 EPS91_09770 EPS94_16700 EPT01_06355 EQ820_00745 EQ823_11615 EQ825_18070 EQ830_03660 EQO00_19840 ERS085362_02676 ERS085366_04179 ERS085379_01215 ERS085386_01096 ERS085404_01742 ERS085406_02227 ERS150873_01858 EST51_18990 ETECE1373_03601 ETECE1441_03612 ETECE1649_03506 ETECE1779_04258 ETECE36_04584 ETECE925_03600 EVY14_00050 EWK56_10245 EXM29_24150 ExPECSC038_04895 ExPECSC065_04439 EXX06_12400 EXX13_09665 EXX23_09965 EXX24_01870 EXX53_07630 EXX55_11875 EXX71_12170 EXX87_11565 EYD11_17450 EYV18_10135 EYX82_01145 EYY27_15550 EYY34_27625 EYY78_10095 F0L67_19465 F1E19_02455 F6T45_22350 F6T51_06360 F6V70_05450 F7F11_06850 F7F23_13355 F7F26_08530 F7F56_11190 F7F79_08660 F7G03_09695 F7G05_12635 F7O57_06490 F9B07_11235 F9X20_010625 F9X20_10705 FAF34_030290 FKC84_04690 FKO60_24460 FNJ67_20330 FNJ69_23475 FORC82_3666 FPI65_02250 FQ021_04720 FQ915_14565 FQU83_20855 FRV13_03860 FTV90_10360 FTV92_11870 FTV93_12360 FV250_14320 FV293_06120 FV295_17245 FV438_20585 FVA71_19985 FWK02_29295 FZC17_02065 FZN26_02330 FZN30_08825 G3565_02860 G4276_18370 G4280_18620 G5606_10990 G5668_11855 G5670_13140 G5680_11755 G5688_07395 G5696_10795 G5697_16390 G5V60_18285 G6Z99_23355 G9448_08700 G9P49_16830 G9P50_16250 GE057_12200 GE087_02515 GE096_15955 GE400_02540 GE558_09695 GFU47_21615 GFY48_03475 GHD50_02110 GIJ01_19765 GIY13_13165 GJ11_02375 GKE29_12130 GKE58_10855 GKE60_09410 GKE79_09230 GKE87_01825 GKF34_16490 GKF52_17565 GKF86_04910 GKF89_04055 GKG12_02940 GNZ02_03615 GNZ05_01665 GP650_16700 GP662_13045 GP666_10645 GP698_13660 GP711_02810 GP720_05730 GP935_14810 GP945_18805 GP946_18990 GP954_12950 GP979_17585 GQE22_09325 GQE33_07115 GQE34_00765 GQE36_18000 GQE42_04900 GQE64_07505 GQE67_02555 GQE87_15550 GQF59_00790 GQM04_16295 GQM06_17115 GQM09_10135 GQM10_05275 GQM13_16755 GQM17_10365 GQM18_17190 GQM28_05335 GQN24_05490 GRC73_12510 GRW02_05020 GRW05_15575 GRW30_07965 GRW57_16360 GRW80_21245 GRW81_04110 GUB08_22335 GUB91_14510 GUB95_14180 GUC01_07480 GUC12_15000 GUC40_07390 GUI16_08025 GUI33_03675 GXC14_20220 H4P50_19265 H4P51_19115 H5C68_16910 H5C80_22515 HAP53_09400 HCR07_11915 HF065_000755 HF523_01165 HF527_18375 HFD31_001236 HFD39_002504 HFD59_003103 HFD69_003066 HFU80_001346 HGR17_22385 HGR87_01460 HGR88_06440 HGS97_11820 HGT58_04135 HH117_07870 HH456_002645 HH707_000108 HH814_000579 HH830_001792 HHA77_001423 HHG54_000763 HHH24_000946 HHH97_002377 HHJ41_01370 HHJ44_22155 HHJ51_05025 HI055_001796 HI083_000480 HIB31_002797 HIF87_003470 HIN76_001080 HIO03_001580 HIO61_000590 HIQ74_001213 HIQ82_002038 HIR91_000876 HIT56_001577 HIZ44_002483 HIZ62_001433 HJ359_001771 HJ411_000554 HJ802_001358 HJI79_003357 HJL93_002730 HJM41_000592 HJM89_001896 HJN45_001169 HJO02_002671 HJO44_000019 HJO53_003212 HJP34_000144 HJQ03_003089 HJR58_002219 HJR60_001095 HJR92_002545 HJS12_001242 HJS53_002270 HJT66_002048 HJT90_002082 HJU54_001570 HJV81_000744 HK427_001468 HKA14_002869 HKA45_002554 HKA57_001676 HKC58_001279 HL152_08835 HL186_02490 HL563_20960 HLI97_000112 HLQ75_07955 HLQ92_12990 HLT96_03035 HLU13_05400 HLU98_04605 HLY53_21035 HLZ85_06695 HmCms169_03669 HmCms184_01874 HmCmsJML074_04353 HmCmsJML079_00649 HmCmsJML146_03132 HmCmsJML204_02343 HMG20_09930 HMG24_12660 HMG27_12270 HMG35_19725 HMP86_22290 HMPREF3040_03387 HMQ05_07470 HMT01_08840 HMT08_08320 HMT08_28135 HMW26_10275 HMW26_27920 HNC38_21355 HNC40_07205 HNC59_10160 HNC73_14325 HNC73_28105 HNC75_03340 HNC80_02630 HNC88_10750 HNC94_01805 HNC99_09055 HND23_10890 HNN86_05540 HNO03_09675 HNO08_21040 HNV44_01815 HNV91_05205 HNX16_02485 HNX34_02410 HNY58_07155 HP431_07725 HPE39_05435 HPE49_20435 HPE52_15660 HPM96_04240 HR075_18950 HS093_08480 HV005_16510 HV021_17015 HV022_17950 HV055_18220 HV065_00215 HV068_18270 HV098_18955 HV108_19500 HV109_18115 HV131_23750 HV149_18435 HV152_17755 HV156_07825 HV159_09785 HV168_09465 HV188_05655 HV226_23340 HV244_16550 HV297_16755 HV303_20415 HV348_18230 HVV37_09655 HVV39_18775 HVV53_22620 HVV73_17755 HVV78_05095 HVV92_19015 HVW09_04615 HVW11_04845 HVW22_00965 HVW33_09625 HVW37_18825 HVW43_10265 HVW44_14930 HVW45_17890 HVW59_08530 HVW60_17400 HVW76_17030 HVW90_08090 HVW93_05045 HVW95_10270 HVW98_04760 HVX00_17970 HVX17_19490 HVX22_17445 HVX24_17055 HVX28_17275 HVX30_05390 HVX33_08680 HVX51_18435 HVX60_09555 HVX73_17865 HVX96_09065 HVY01_17550 HVY77_19945 HVY79_05095 HVY93_17995 HVZ20_05415 HVZ21_18085 HVZ24_17385 HVZ33_18480 HVZ42_18115 HVZ44_17970 HVZ47_04860 HVZ53_18680 HVZ62_09000 HVZ71_18990 HWQ66_23340 HX136_19525 HZT35_11660 IB283_04800 IEM32_07330 IMQ59_17410 JE86ST02C_04160 JE86ST05C_04220 MJ49_04490 MS8345_00396 NCTC10082_01078 NCTC10089_03910 NCTC10418_05682 NCTC10429_03762 NCTC10764_05371 NCTC10767_04209 NCTC10865_04787 NCTC11022_05137 NCTC11126_00022 NCTC11181_01145 NCTC11341_03896 NCTC12950_04180 NCTC13127_05156 NCTC13216_02895 NCTC13846_03688 NCTC7922_06246 NCTC7927_04270 NCTC8009_07014 NCTC8179_01642 NCTC8450_01367 NCTC8500_04283 NCTC8621_03984 NCTC8622_02997 NCTC8959_05017 NCTC8960_01314 NCTC8985_02798 NCTC9001_00537 NCTC9007_00270 NCTC9036_03840 NCTC9044_03501 NCTC9045_04434 NCTC9050_01764 NCTC9055_00703 NCTC9058_03120 NCTC9062_04466 NCTC9075_05103 NCTC9077_04792 NCTC9081_02496 NCTC9111_03977 NCTC9117_04804 NCTC9119_03997 NCTC9434_02812 NCTC9701_04128 NCTC9702_04480 NCTC9703_03222 NCTC9706_01114 NCTC9777_00174 NCTC9969_04032 PGD_02920 PU06_02955 RG28_02910 RG36_04960 RK56_026705 RM34_04980 RX35_02064 SAMEA3472043_02682 SAMEA3472044_00466 SAMEA3472047_02102 SAMEA3472055_02163 SAMEA3472056_03633 SAMEA3472070_02281 SAMEA3472080_01810 SAMEA3472090_01813 SAMEA3472108_01855 SAMEA3472110_00729 SAMEA3472112_02965 SAMEA3472114_01257 SAMEA3472147_04902 SAMEA3484427_03543 SAMEA3484429_01888 SAMEA3484434_01710 SAMEA3485101_03989 SAMEA3751407_02141 SAMEA3752372_02749 SAMEA3752553_00287 SAMEA3752557_00215 SAMEA3752559_02897 SAMEA3752620_00785 SAMEA3753064_01236 SAMEA3753097_00513 SAMEA3753164_00218 SAMEA3753290_01725 SAMEA3753300_00458 SK85_00418 SY51_02060 TUM18780_32860 UC41_24265 UN86_08900 UN91_18725 WP2S18E08_35360 WP4S17E03_35290 WP4S17E08_35200 WP4S18E07_34480 WP4S18E08_34230 WP5S18E09_34520 WP7S17E01_36800 WP7S17E04_33320 WP7S18E09_37190 WQ89_01420 WR15_04360 YDC107_3656] Pyrimidine/purine nucleoside phosphorylase (EC 2.4.2.1) (EC 2.4.2.2) (Adenosine phosphorylase) (Cytidine phosphorylase) (Guanosine phosphorylase) (EC 2.4.2.15) (Inosine phosphorylase) (Thymidine phosphorylase) (EC 2.4.2.4) (Uridine phosphorylase) (EC 2.4.2.3) (Xanthosine phosphorylase)
[NFIL3 E4BP4 IL3BP1] Nuclear factor interleukin-3-regulated protein (E4 promoter-binding protein 4) (Interleukin-3 promoter transcriptional activator) (Interleukin-3-binding protein 1) (Transcriptional activator NF-IL3A)
[IL1R1 IL1R IL1RA IL1RT1] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL36RN FIL1D IL1F5 IL1HY1 IL1L1 IL1RP3 UNQ1896/PRO4342] Interleukin-36 receptor antagonist protein (IL-36Ra) (FIL1 delta) (IL-1-related protein 3) (IL-1RP3) (Interleukin-1 HY1) (IL-1HY1) (Interleukin-1 delta) (IL-1 delta) (Interleukin-1 family member 5) (IL-1F5) (Interleukin-1 receptor antagonist homolog 1) (IL-1ra homolog 1) (Interleukin-1-like protein 1) (IL-1L1)
[IL37 FIL1Z IL1F7 IL1H4 IL1RP1] Interleukin-37 (IL-37) (FIL1 zeta) (IL-1X) (Interleukin-1 family member 7) (IL-1F7) (Interleukin-1 homolog 4) (IL-1H) (IL-1H4) (Interleukin-1 zeta) (IL-1 zeta) (Interleukin-1-related protein) (IL-1RP1) (Interleukin-23) (IL-23)
[IL18 IGIF IL1F4] Interleukin-18 (IL-18) (Iboctadekin) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
[IL17RC UNQ6118/PRO20040/PRO38901] Interleukin-17 receptor C (IL-17 receptor C) (IL-17RC) (Interleukin-17 receptor homolog) (IL17Rhom) (Interleukin-17 receptor-like protein) (IL-17RL) (ZcytoR14)
[IL1RAP C3orf13 IL1R3] Interleukin-1 receptor accessory protein (IL-1 receptor accessory protein) (IL-1RAcP) (EC 3.2.2.6) (Interleukin-1 receptor 3) (IL-1R-3) (IL-1R3)
[Il1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[tat] Protein Tat (Transactivating regulatory protein)
[IL36G IL1E IL1F9 IL1H1 IL1RP2 UNQ2456/PRO5737] Interleukin-36 gamma (IL-1-related protein 2) (IL-1RP2) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 9) (IL-1F9) (Interleukin-1 homolog 1) (IL-1H1)
[IL36RN Fil1d Il1f5 Il1h3 Il1hy1] Interleukin-36 receptor antagonist protein (IL-36Ra) (Interleukin-1 HY1) (IL-1HY1) (Interleukin-1 delta) (IL-1 delta) (Interleukin-1 family member 5) (IL-1F5) (Interleukin-1 homolog 3) (IL-1H3) (Interleukin-1-like protein 1) (IL-1L1)
[IL4R IL4RA 582J2.1] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il36a Fil1e Il1e Il1f6 Il1h1] Interleukin-36 alpha (FIL1 epsilon) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 6) (IL-1F6) (Interleukin-1 homolog 1) (IL-1H1)
[IL36B IL1F8 IL1H2] Interleukin-36 beta (FIL1 eta) (Interleukin-1 eta) (IL-1 eta) (Interleukin-1 family member 8) (IL-1F8) (Interleukin-1 homolog 2) (IL-1H2)
[IL36A FIL1E IL1E IL1F6] Interleukin-36 alpha (FIL1 epsilon) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 6) (IL-1F6)
[IL1B IL1F2] Interleukin-1 beta (IL-1 beta) (Catabolin)
[IL18RAP IL1R7] Interleukin-18 receptor accessory protein (IL-18 receptor accessory protein) (IL-18RAcP) (EC 3.2.2.6) (Accessory protein-like) (AcPL) (CD218 antigen-like family member B) (CDw218b) (IL-1R accessory protein-like) (IL-1RAcPL) (Interleukin-1 receptor 7) (IL-1R-7) (IL-1R7) (Interleukin-18 receptor accessory protein-like) (Interleukin-18 receptor beta) (IL-18R-beta) (IL-18Rbeta) (CD antigen CD218b)
[IRAK3] Interleukin-1 receptor-associated kinase 3 (IRAK-3) (IL-1 receptor-associated kinase M) (IRAK-M) (Inactive IL-1 receptor-associated kinase 3)
[IL1A IL1F1] Interleukin-1 alpha (IL-1 alpha) (Hematopoietin-1)
[nnr nnrD nnrE A3104_11915 A3S30_19665 A3T81_21675 A3U32_23435 A3V03_21575 A3V89_22115 A3W57_22140 A3X15_22160 A3X55_21685 A3Y76_14605 A4N07_22285 A4O05_13700 A4O41_05265 A4R48_22080 A9U69_22255 AAA76_20340 AAB27_18985 AAB79_03070 AAC35_06000 ADQ28_23005 AF497_21520 AGM99_01505 AHN93_01515 AKH62_11790 AL144_04480 AL168_02095 AL184_03665 AQ530_03515 AU613_19740 AVA38_18590 AVC05_01495 AVL16_22555 AWT30_09535 AXX99_06020 B1265_01505 B1398_16630 B1642_23230 B1P38_04920 B2E31_03355 B4V59_03840 B4W90_14915 B6362_05595 B7Q27_01505 B8Y16_05865 B8Z46_22290 B9C90_07460 B9C96_05405 B9M14_07545 B9O84_03660 BBQ66_05585 BIC00_08330 BIC13_14510 BK110_09575 BKM50_11315 BMS46_01505 BMU56_09035 BZ203_06955 BZZ88_08070 C5W43_08230 CA117_06625 CB102_00985 CB119_00985 CB198_09030 CB380_07720 CB535_06910 CB570_00990 CB646_05015 CBM67_21760 CBM76_21380 CBZ90_21695 CC339_04035 CC403_03335 CC453_02040 CC652_09145 CC971_07405 CCP17_01500 CDZ72_03200 CE70_13525 CED07_02655 CEQ70_07505 CFF58_07550 CFF59_07100 CHN22_19910 CIX60_07020 CPS79_03750 CQO33_04955 CSG22_03545 CVR97_09130 D4361_14445 D4387_09005 D4422_03410 D5823_20700 D5N86_01575 D5N95_09780 D5O82_05670 D5P17_06815 D5X47_11065 D5Y28_07745 D6422_22155 D6J79_11255 D8S24_10700 DD95_00965 DLB93_10975 DLR28_11595 DMI89_05845 DMO92_10880 DN165_10610 DNB97_07755 DNM27_05145 DNZ37_05180 DO533_23225 DP680_10960 DPB42_02650 DPD91_03510 DPF41_01580 DPF68_05705 DPS76_03370 DQD22_12500 DQR44_06210 DRM14_08770 DRR75_10500 DRT38_04095 DRT61_07200 DRV05_05125 DSF94_09655 DSG41_17540 DTF68_08880 DU071_23815 DU223_08415 DU657_03970 DU879_06050 DUV75_11535 DWU22_16565 DY580_23265 DYM27_14705 E0935_23310 E1A11_11805 E6W45_09715 EBD14_10340 EBK21_08710 EC404_02370 EEQ30_18160 EER35_22295 EHB09_20270 EL822_04855 ELS01_25275 EPB30_12745 EQG93_06630 EVY71_20440 EW905_04205 F0D96_20705 F2P00_23020 F3Q97_10065 F3R12_05435 F9G02_04855 F9O44_00990 FEM52_07875 FGZ46_01505 FJM64_10520 FQC24_12860 FQX78_09970 G0038_10260 G0040_04475 G0042_07685 G0045_12485 G0047_13855 G0048_12905 G0051_11450 G0052_23590 G0059_11030 G0061_11920 G0062_12500 G0063_16275 G0067_13985 G0069_12775 G0070_08950 G0071_12535 G0072_10310 G0074_12900 G0076_15880 G0077_12835 G0080_14965 G0084_15965 G0086_13840 G0087_12905 G0088_11920 G0089_06320 G0090_22420 G0094_13250 G0100_12665 G0101_09385 G0102_12000 G0111_21240 G0113_13510 G0117_14430 G0123_12905 G0124_09920 G0148_23065 G0157_12325 G0170_23555 G0A05_04765 G0A32_05580 G0A39_06255 G0A43_05040 G0A44_08470 G0A46_12965 G0A50_23545 G0A51_09275 G0A52_05740 G0A53_07565 G0A56_07500 G0A58_07465 G0A60_17995 G0A61_07660 G0A63_04815 G0A66_08960 G0A67_07200 G0A68_05690 G0A70_08885 G0A73_09480 G0A76_08590 G0A79_21840 G0A92_10225 G0A96_08865 G0A97_09115 G0B03_12655 G0B05_09390 G0B07_10975 G0B08_22950 G0B12_10720 G0B96_04785 G0C03_12575 G0C04_15660 G0C34_07535 G0E15_19110 G0E20_06140 G0G84_16105 G0J24_13730 G0J26_12305 G0J27_07115 G0J28_11980 G0J31_06745 G0J33_11145 G0J34_13415 G0J36_08765 G0J37_20200 G0J40_10310 G0J43_01545 G0J44_20410 G0J45_08730 G0J46_15460 G0J47_19830 G0J49_09500 G0J50_01555 G0J51_10340 G0J53_08850 G0J55_19430 G0J58_22670 G0J59_05635 G0J62_17815 G0J65_08725 G0J66_21925 G0J67_22665 G0J69_22465 G0J71_22025 G0J73_03995 G0J76_22400 G0J79_23305 G0J81_19270 G0J82_03865 G0J85_22590 G0J89_01555 G0J92_05645 G0J94_04410 G0J96_06855 G0J97_18065 G0K00_04765 G0K02_10715 G0K03_10995 G0K04_02780 G0K05_22985 G0K07_22440 G0K10_01565 G0K13_11525 G0K15_08960 G0K16_08385 G0K18_04715 G0K19_01430 G0K20_20560 G0K23_09085 G0K25_22280 G0K26_23210 G0K28_09270 G0K30_24080 G0K31_21360 G0K32_21370 G0K33_22125 G0K37_22810 G0K38_06715 G0K39_19020 G0K41_13810 G0K42_10880 G0K44_22730 G0K46_22315 G0K47_08680 G0K48_01555 G0K49_05675 G0K52_04405 G0K53_04950 G0K56_04645 G0K58_19550 G0K59_01555 G0K61_05520 G0K65_10910 G0K68_01545 G0K70_23295 G0K72_19895 G0K74_23665 G0K75_23255 G0K78_05095 G0K80_01550 G0K83_07510 G0K84_09810 G0K85_01555 G0K88_000683 G0K89_000568 G0K90_000508 G0K95_003755 G0L00_001859 G0L02_000638 G0L03_05870 G0L06_06150 G0L07_08375 G0L10_19990 G0L14_06770 G0L15_02230 G0L18_05635 G0L19_08200 G0L20_14575 G0L24_07325 G0L25_04935 G0L29_02685 G0L31_03775 G0L32_04710 G0L34_14860 G0L35_12865 G0L36_13035 G0L37_07105 G0L38_11275 G0L40_12750 G0L42_10750 G0L48_09545 G0L49_06730 G0L51_08560 G0L52_09595 G0L55_08545 G0L59_07010 G0L62_08790 G0L63_08395 G0L65_11350 G0L67_07070 G0L68_21135 G0L70_01495 G0L73_21325 G0L76_10450 G0L77_03505 G0L78_05795 G0L79_07425 G0L83_10615 G0L86_001595 G0L88_06510 G0L89_08150 G0L91_03255 G0L93_04345 G0L96_08625 G0L98_04340 G0M00_03415 G0M02_06865 G0M05_13160 G0M06_001385 G0M13_001162 G0M14_16700 G0M16_07260 G0M18_003813 G0M21_02335 G0M22_001379 G0M25_001199 G0M26_21090 G0M29_001394 G0M30_19890 G0M33_23770 G0M35_21125 G0M36_15025 G0M38_15125 G0M39_17915 G0M41_17560 G0M45_03860 G0M46_001382 G0M48_003206 G0M53_18855 G0M55_07255 G0M56_08145 G0M58_08160 G0M63_07175 G0M65_06665 G0M67_08355 G0N45_22995 G0N48_14040 G0N51_03825 G0N53_22980 G0N55_11400 G0N57_00010 G0N58_23005 G0N59_23010 G0N60_23095 G0N61_09375 G0N62_22990 G0N64_11025 G0N65_22930 G0N66_23085 G0N67_23065 G0N71_04780 G0N75_16110 G0N78_21895 G0N82_10545 G0N84_15350 G0N85_24040 G0N86_23095 G0N88_10630 G0N89_10800 G0N90_22705 G0N92_17760 G0N94_20330 G0N95_23625 G0N98_20980 G0N99_05765 G0O00_05695 G0O10_23100 G0O14_22860 G0O15_07010 G0O18_13745 G0O19_12975 G0O20_05410 G0O22_22985 G0O25_22615 G0O27_09925 G0O31_10850 G0O32_22285 G0O36_10155 G0O37_07040 G0O39_16130 G0O40_13640 G0O41_10340 G0O42_04595 G0O43_15605 G0O44_11700 G0O47_09535 G0O52_22165 G0O55_11440 G0O57_04595 G0O58_14540 G0O59_06805 G0O60_22680 G0O63_06090 G0O66_07220 G0O68_10375 G0O70_11530 G0O71_09735 G0O74_04410 G0O75_09695 G0O77_22825 G0O78_09545 G0O80_11320 G0O81_07145 G0O82_16905 G0O84_11320 G0O85_15450 G0O86_04490 G0O87_13110 G0O88_07290 G0O89_16570 G0O92_14075 G0O93_16785 G0O94_04825 G0O97_23030 G0O99_03030 G0P00_05830 G0P01_06470 G0P02_09955 G0P05_04495 G0P06_22950 G0P08_07305 G0P12_03840 G0P13_16225 G0P17_10905 G0P18_15755 G0P19_12705 G0P24_08485 G0P26_09735 G0P28_11835 G0P30_09670 G0P31_13405 G0P36_11580 G0P37_07140 G0P41_06990 G0P44_09010 G0P45_10700 G0P48_10900 G0P49_04240 G0P52_08565 G0P53_13455 G0P56_10915 G0P57_09940 G0P58_22400 G0P63_18010 G0P65_10045 G0P67_06260 G0P68_03795 G0P69_22335 G0P73_18280 G0P75_23960 G0P76_04350 G1N61_10720 G1N64_12415 G1N66_12405 G1N68_12100 G1N71_13250 G1N72_12410 G1N86_13550 G1N87_12430 G1N91_14270 G1O00_12660 G1O02_13555 G1O04_12420 G1O05_12405 G1O08_13535 G1O10_12410 G1O12_13560 G1O16_13555 G1O17_12180 G1O18_13555 G1O20_13550 G1O23_12420 G1O25_13545 G1O26_13550 G1O27_12485 G1O28_13315 G1O29_12480 G1O32_13540 G1O34_13620 G1O38_13960 G1O40_13560 G1O43_13545 G1O46_12060 G1O48_13325 G1O49_12535 G1O51_13550 G1O53_13615 G1O62_13555 G1O63_13540 G1O65_13325 G1O67_12870 G1O68_11720 G1O69_13110 G1O71_13105 G1O72_11855 G1O76_13635 G1O77_13550 G1O80_13640 G1O81_12410 G1O83_12005 G1O84_13630 G1O87_13635 G1O88_13625 G1O89_13560 G1O90_13630 G1O93_13625 G1O94_13620 G1O96_13625 G1P02_13620 G1P03_13280 G1P06_13300 G1P09_12575 G1P10_13575 G1P12_13625 G1P14_10175 G1P15_13970 G1P17_13640 G1P19_13625 G1P23_13630 G1P24_13545 G1P25_11855 G1P26_13545 G1P29_13260 G1P31_13615 G1P35_13550 G1P36_13545 G1P37_13205 G1P40_12430 G1P44_13550 G1P45_13630 G1P47_12485 G1P48_13630 G1P51_13630 G1P52_13205 G1P53_13205 G1P54_13640 G1P55_13320 G1P56_13610 G1P57_10720 G1P58_13620 G1P59_13635 G1P61_23980 G1P64_13325 G1P67_13625 G1P69_13540 G1P72_12515 G1P75_13570 G1P76_13215 G1P78_12495 G1P83_12225 G1P84_13555 G1P87_13625 G1P90_13360 G1P91_13620 G1Q03_13235 G1Q08_12720 G1Q67_13630 G1Q78_09875 G1Q81_11340 G1Q83_12495 G1Q84_08650 G1Q85_11365 G1Q86_11715 G1Q88_11725 G1Q90_12170 G1Q91_12420 G1Q93_09170 G1Q96_12385 G1Q98_11910 G1Q99_22335 G1R01_13545 G1R02_12655 G1R03_13625 G1R04_13570 G1R08_09245 G1R13_11975 G1R15_09440 G1R20_14345 G1R21_11475 G1R22_11285 G1R23_08760 G1R27_12005 G1R28_13075 G1R29_13635 G1R30_13320 G1R31_12250 G1R36_13635 G1R38_18180 G1R40_12255 G1R42_13550 G1R44_13315 G1R45_09940 G1R47_12850 G1R48_06440 G1R51_12400 G1R53_13630 G1R63_13630 G1R69_09725 G1R87_11980 G1R93_13230 G1S02_12495 G2203_22150 G2212_02390 G2218_05480 G2279_10500 G2290_05710 G2793_13060 G2918_01515 G2951_22815 G3221_001120 G3230_002225 G3231_004971 G3247_000621 G3248_004290 G3254_000657 G3263_001003 G3270_000223 G3275_001976 G3312_001342 G3336_003846 G3357_000830 G3369_001554 G3433_000423 G3460_002051 G3464_000047 G3593_001051 G3A35_04535 G3V06_004409 G3V14_001761 G3V17_001609 G3V21_004148 G3V56_001941 G3V57_003126 G3X03_004298 G4189_001618 G4190_004249 G4192_004192 G4198_004562 G4201_003798 G4202_000501 G4A01_003580 G4A73_001420 G4A83_004704 G4A85_001081 G4A87_001998 G4B68_002875 G4B72_004591 G4B74_004402 G4C74_001467 G4D32_001167 G4D46_001331 G4F88_03160 G4F89_21210 G4F91_20865 G4F92_03160 G4G47_000304 G4G62_000179 G4G67_004715 G4G68_000780 G4G75_001230 G4G76_001971 G4G79_000501 G4G97_000963 G4H00_001841 G4H04_001859 G4H07_000277 G4H08_000970 G4H18_001970 G4H21_002013 G4H24_001959 G4H63_001799 G4I66_002109 G4J07_003114 G4J08_001003 G4J11_003314 G4J12_003592 G4J18_002204 G4J20_000694 G4J37_001805 G4J39_003834 G4J41_001252 G4J45_004787 G4J90_001032 G4K02_004567 G4K03_004658 G4O54_001852 G4O56_000652 G4O59_004375 G4O60_004588 G4O67_004614 G4O69_001138 G4P29_002660 G4P83_002002 G4P85_001270 G4P89_000745 G4P91_004289 G4P93_000925 G4Q12_001216 G4Q28_001959 G4Q31_001958 G4Q50_001423 G4Q52_001423 G4Q59_000925 G4Q60_001509 G4Q63_001410 G4Q67_000417 G4Q94_000976 G4R01_002882 G4R02_000925 G4R15_001414 G4R16_001699 G4W68_001327 G4W73_003000 G4W86_001855 G4W87_002248 G4W88_003688 G4W91_000984 G4Y10_001706 G9269_001321 G9302_002068 G9304_000623 G9305_000797 G9309_000779 G9313_001438 G9314_004671 G9367_002779 G9381_001217 G9C24_000440 G9C41_004428 G9C46_004336 G9C47_004352 G9C49_004415 G9C57_002249 G9C64_001580 G9G03_000673 G9G04_001975 G9G34_002649 G9G36_001047 G9G45_002358 G9G50_004591 G9G62_003596 G9W19_000375 G9W28_000842 G9W45_004104 G9W52_000348 G9W63_004309 G9W65_001966 G9W79_001611 G9W95_001967 G9W96_001102 G9X40_004481 GB021_08410 GB040_02730 GB055_01495 GB076_03915 GB106_04175 GB114_03815 GB120_06665 GB122_01510 GB131_04255 GB139_07780 GB171_05240 GB209_06680 GB221_02485 GB224_18770 GB238_04475 GB280_15095 GB321_14890 GB331_05905 GB339_01505 GB342_22590 GB368_02475 GB372_02445 GB416_20360 GB452_19400 GB459_04825 GB466_07010 GB505_01510 GB510_08155 GB551_22950 GB567_07675 GB645_04690 GBS44_18590 GBS58_08845 GBV53_08360 GBV54_07315 GBV60_03815 GBW03_05075 GBW44_01505 GBW52_23040 GBW76_04840 GBX12_03395 GBX20_03490 GBX46_04595 GBX55_05300 GBX64_06335 GBY13_09745 GBY23_03830 GBY73_10270 GBZ51_12095 GBZ55_06105 GCZ80_05780 GEZ01_12305 GJE27_23785 GJE28_09790 GNA88_000904 GNA97_000970 GNA99_000904 GNB28_004056 GNB36_002380 GNB86_002038 GNC11_002712 GNC19_000953 GNC45_001979 GNC75_001243 GNC95_002115 GND07_000714 GT380_09345 GTH60_13735 GTH62_10815 GTH63_22565 GTH66_18970 GTH67_23365 GTH68_14080 GTH70_07920 GTH72_05435 GTH73_08455 GTH75_09290 GTH78_07295 GTH79_20650 GTH81_19855 GTH85_10175 GTH87_13350 GTH89_08935 GTH90_17910 GTH91_11235 GTH93_14555 GTH94_11265 GTH99_14850 GXC51_01500 GXC56_01500 GXG40_01500 GYI58_05740 GYI62_001805 GYI77_07850 GYJ04_14695 GYJ24_08660 GYJ27_23070 GYJ28_003286 GYJ30_22330 GYJ32_15480 GYJ53_13635 GYJ59_07255 GYJ60_13615 H8S97_22220 KP44_01505 NG06_15025 R035_14735 Z700_13005 ZV33_21500 ZX03_19885 ZY40_08180] Bifunctional NAD(P)H-hydrate repair enzyme (Nicotinamide nucleotide repair protein) [Includes: ADP-dependent (S)-NAD(P)H-hydrate dehydratase (EC 4.2.1.136) (ADP-dependent NAD(P)HX dehydratase); NAD(P)H-hydrate epimerase (EC 5.1.99.6)]

Bibliography :