GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interleukin-36 gamma (IL-1-related protein 2) (IL-1RP2) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 9) (IL-1F9) (Interleukin-1 homolog 1) (IL-1H1)

 IL36G_HUMAN             Reviewed;         169 AA.
Q9NZH8; Q56B91; Q6UVX7; Q7RTZ9;
08-NOV-2002, integrated into UniProtKB/Swiss-Prot.
01-OCT-2000, sequence version 1.
17-JUN-2020, entry version 156.
RecName: Full=Interleukin-36 gamma;
AltName: Full=IL-1-related protein 2;
Short=IL-1RP2;
AltName: Full=Interleukin-1 epsilon;
Short=IL-1 epsilon;
AltName: Full=Interleukin-1 family member 9;
Short=IL-1F9;
AltName: Full=Interleukin-1 homolog 1;
Short=IL-1H1;
Flags: Precursor;
Name=IL36G; Synonyms=IL1E, IL1F9, IL1H1, IL1RP2; ORFNames=UNQ2456/PRO5737;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND INDUCTION.
TISSUE=Keratinocyte;
PubMed=10744718; DOI=10.1074/jbc.275.14.10308;
Kumar S., McDonnell P.C., Lehr R., Tierney L., Tzimas M.N., Griswold D.E.,
Capper E.A., Tal-Singer R., Wells G.I., Doyle M.L., Young P.R.;
"Identification and initial characterization of four novel members of the
interleukin-1 family.";
J. Biol. Chem. 275:10308-10314(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND CHARACTERIZATION.
TISSUE=Epithelium;
PubMed=11466363; DOI=10.4049/jimmunol.167.3.1440;
Debets R., Timans J.C., Homey B., Zurawski S., Sana T.R., Lo S., Wagner J.,
Edwards G., Clifford T., Menon S., Bazan J.F., Kastelein R.A.;
"Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an
antagonist and agonist of NF-kappa B activation through the orphan IL-1
receptor-related protein 2.";
J. Immunol. 167:1440-1446(2001).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=10860666; DOI=10.1006/geno.2000.6184;
Busfield S.J., Comrack C.A., Yu G., Chickering T.W., Smutko J.S., Zhou H.,
Leiby K.R., Holmgren L.M., Gearing D.P., Pan Y.;
"Identification and gene organization of three novel members of the IL-1
family on human chromosome 2.";
Genomics 66:213-216(2000).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=11991722; DOI=10.1006/geno.2002.6751;
Nicklin M.J.H., Barton J.L., Nguyen M., Fitzgerald M.G., Duff W.G.,
Kornman K.;
"A sequence-based map of the nine genes of the human interleukin-1
cluster.";
Genomics 79:718-725(2002).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A.,
Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D.,
Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L.,
Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C.,
Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J.,
Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale effort to
identify novel human secreted and transmembrane proteins: a bioinformatics
assessment.";
Genome Res. 13:2265-2270(2003).
[6]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
SeattleSNPs variation discovery resource;
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P.,
Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C.,
Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L.,
Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A.,
Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J.,
Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M.,
Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T.,
Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S.,
Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S.,
Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C.,
Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M.,
Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C.,
Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J.,
Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E.,
Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X.,
Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M.,
Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H.,
Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2 and
4.";
Nature 434:724-731(2005).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
FUNCTION, TISSUE SPECIFICITY, AND SUBCELLULAR LOCATION.
PubMed=20870894; DOI=10.1165/rcmb.2010-0075oc;
Chustz R.T., Nagarkar D.R., Poposki J.A., Favoreto S. Jr., Avila P.C.,
Schleimer R.P., Kato A.;
"Regulation and function of the IL-1 family cytokine IL-1F9 in human
bronchial epithelial cells.";
Am. J. Respir. Cell Mol. Biol. 45:145-153(2011).
[10]
FUNCTION, AND PROCESSING.
PubMed=21965679; DOI=10.1074/jbc.m111.267922;
Towne J.E., Renshaw B.R., Douangpanya J., Lipsky B.P., Shen M., Gabel C.A.,
Sims J.E.;
"Interleukin-36 (IL-36) ligands require processing for full agonist (IL-
36alpha, IL-36beta, and IL-36gamma) or antagonist (IL-36Ra) activity.";
J. Biol. Chem. 286:42594-42602(2011).
[11]
FUNCTION, AND TISSUE SPECIFICITY.
PubMed=23095752; DOI=10.1074/jbc.m112.385443;
Bachmann M., Scheiermann P., Hardle L., Pfeilschifter J., Muhl H.;
"IL-36gamma/IL-1F9, an innate T-bet target in myeloid cells.";
J. Biol. Chem. 287:41684-41696(2012).
[12]
FUNCTION, AND INDUCTION.
PubMed=23147407; DOI=10.1002/eji.201242711;
Gresnigt M.S., Roesler B., Jacobs C.W., Becker K.L., Joosten L.A.,
van der Meer J.W., Netea M.G., Dinarello C.A., van de Veerdonk F.L.;
"The IL-36 receptor pathway regulates Aspergillus fumigatus-induced Th1 and
Th17 responses.";
Eur. J. Immunol. 43:416-426(2013).
[13]
FUNCTION.
PubMed=24829417; DOI=10.4049/jimmunol.1301481;
Foster A.M., Baliwag J., Chen C.S., Guzman A.M., Stoll S.W.,
Gudjonsson J.E., Ward N.L., Johnston A.;
"IL-36 promotes myeloid cell infiltration, activation, and inflammatory
activity in skin.";
J. Immunol. 192:6053-6061(2014).
-!- FUNCTION: Cytokine that binds to and signals through the IL1RL2/IL-36R
receptor which in turn activates NF-kappa-B and MAPK signaling pathways
in target cells. Part of the IL-36 signaling system that is thought to
be present in epithelial barriers and to take part in local
inflammatory response; similar to the IL-1 system with which it shares
the coreceptor IL1RAP. Seems to be involved in skin inflammatory
response by acting on keratinocytes, dendritic cells and indirectly on
T-cells to drive tissue infiltration, cell maturation and cell
proliferation. In cultured keratinocytes induces the expression of
macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4,
CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20
and CXCL1; also stimulates its own expression and that of the
prototypic cutaneous proinflammatory parameters TNF-alpha,
S100A7/psoriasin and inducible NOS. May play a role in proinflammatory
responses during particular neutrophilic airway inflammation: activates
mitogen-activated protein kinases and NF-kappa B in primary lung
fibroblasts, and stimulates the expression of IL-8 and CXCL3 and Th17
chemokine CCL20 in lung fibroblasts. May be involved in the innate
immune response to fungal pathogens, such as Aspergillus fumigatus.
{ECO:0000269|PubMed:11466363, ECO:0000269|PubMed:20870894,
ECO:0000269|PubMed:21965679, ECO:0000269|PubMed:23095752,
ECO:0000269|PubMed:23147407, ECO:0000269|PubMed:24829417}.
-!- SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:20870894}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9NZH8-1; Sequence=Displayed;
Name=2;
IsoId=Q9NZH8-2; Sequence=VSP_013002;
-!- TISSUE SPECIFICITY: Highly expressed in tissues containing epithelial
cells: skin, lung, stomach and esophagus. Expressed in bronchial
epithelial. In skin is expressed only in keratinocytes but not in
fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional
psoriasis skin. Expressed in monocyte-derived dendritic cells and M1
macrophages. {ECO:0000269|PubMed:20870894,
ECO:0000269|PubMed:23095752}.
-!- INDUCTION: By TNF and by IFNG/IFN-gamma in keratinocytes. By
Aspergillus fumigatus conidia in peripheral blood mnonocytes; involves
CLEC7A and SYK. {ECO:0000269|PubMed:10744718,
ECO:0000269|PubMed:23147407}.
-!- PTM: N-terminal truncation leads to a dramatic enhancement of its
activity (>1000-fold). {ECO:0000269|PubMed:21965679}.
-!- SIMILARITY: Belongs to the IL-1 family. {ECO:0000305}.
-!- WEB RESOURCE: Name=Wikipedia; Note=Interleukin-1 entry;
URL="https://en.wikipedia.org/wiki/Interleukin_1";
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il1f9/";
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AF200492; AAF69248.1; -; mRNA.
EMBL; AF206696; AAG35670.1; -; mRNA.
EMBL; BN000002; CAD29874.1; -; Genomic_DNA.
EMBL; AY359111; AAQ89469.1; -; mRNA.
EMBL; AY968311; AAX59035.1; -; Genomic_DNA.
EMBL; AC016724; AAY14987.1; -; Genomic_DNA.
EMBL; BC096721; AAH96721.1; -; mRNA.
EMBL; BC098130; AAH98130.1; -; mRNA.
EMBL; BC098155; AAH98155.1; -; mRNA.
EMBL; BC098337; AAH98337.1; -; mRNA.
CCDS; CCDS2108.1; -. [Q9NZH8-1]
CCDS; CCDS62992.1; -. [Q9NZH8-2]
RefSeq; NP_001265497.1; NM_001278568.1. [Q9NZH8-2]
RefSeq; NP_062564.1; NM_019618.3. [Q9NZH8-1]
PDB; 4IZE; X-ray; 2.00 A; A=18-169.
PDB; 4P0J; X-ray; 2.30 A; A/B=154-160.
PDB; 4P0K; X-ray; 1.70 A; A=64-72, A=154-160.
PDB; 4P0L; X-ray; 1.55 A; A=64-72, A=154-160.
PDB; 6P9E; X-ray; 2.00 A; A=18-169.
PDBsum; 4IZE; -.
PDBsum; 4P0J; -.
PDBsum; 4P0K; -.
PDBsum; 4P0L; -.
PDBsum; 6P9E; -.
SMR; Q9NZH8; -.
BioGRID; 121135; 10.
IntAct; Q9NZH8; 4.
STRING; 9606.ENSP00000259205; -.
iPTMnet; Q9NZH8; -.
PhosphoSitePlus; Q9NZH8; -.
BioMuta; IL36G; -.
EPD; Q9NZH8; -.
MassIVE; Q9NZH8; -.
PaxDb; Q9NZH8; -.
PeptideAtlas; Q9NZH8; -.
PRIDE; Q9NZH8; -.
ProteomicsDB; 83397; -. [Q9NZH8-1]
ProteomicsDB; 83398; -. [Q9NZH8-2]
Antibodypedia; 33310; 292 antibodies.
Ensembl; ENST00000259205; ENSP00000259205; ENSG00000136688. [Q9NZH8-1]
Ensembl; ENST00000376489; ENSP00000365672; ENSG00000136688. [Q9NZH8-2]
GeneID; 56300; -.
KEGG; hsa:56300; -.
UCSC; uc002tio.3; human. [Q9NZH8-1]
CTD; 56300; -.
DisGeNET; 56300; -.
EuPathDB; HostDB:ENSG00000136688.10; -.
GeneCards; IL36G; -.
HGNC; HGNC:15741; IL36G.
HPA; ENSG00000136688; Tissue enhanced (lymphoid tissue, skin, tongue).
MIM; 605542; gene.
neXtProt; NX_Q9NZH8; -.
OpenTargets; ENSG00000136688; -.
PharmGKB; PA38395; -.
eggNOG; ENOG410J1V3; Eukaryota.
eggNOG; ENOG4111C31; LUCA.
GeneTree; ENSGT00950000182943; -.
HOGENOM; CLU_095373_1_1_1; -.
InParanoid; Q9NZH8; -.
KO; K05487; -.
OMA; MCLFCED; -.
OrthoDB; 1502484at2759; -.
PhylomeDB; Q9NZH8; -.
TreeFam; TF300203; -.
Reactome; R-HSA-9014826; Interleukin-36 pathway.
SignaLink; Q9NZH8; -.
BioGRID-ORCS; 56300; 3 hits in 782 CRISPR screens.
GeneWiki; IL1F9; -.
GenomeRNAi; 56300; -.
Pharos; Q9NZH8; Tbio.
PRO; PR:Q9NZH8; -.
Proteomes; UP000005640; Chromosome 2.
RNAct; Q9NZH8; protein.
Bgee; ENSG00000136688; Expressed in periodontal ligament and 62 other tissues.
ExpressionAtlas; Q9NZH8; baseline and differential.
Genevisible; Q9NZH8; HS.
GO; GO:0005576; C:extracellular region; TAS:Reactome.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0005125; F:cytokine activity; IBA:GO_Central.
GO; GO:0005149; F:interleukin-1 receptor binding; IEA:InterPro.
GO; GO:0007267; P:cell-cell signaling; TAS:ProtInc.
GO; GO:0071222; P:cellular response to lipopolysaccharide; IBA:GO_Central.
GO; GO:0019221; P:cytokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0006954; P:inflammatory response; IBA:GO_Central.
GO; GO:0002437; P:inflammatory response to antigenic stimulus; IBA:GO_Central.
GO; GO:0045087; P:innate immune response; IEA:UniProtKB-KW.
GO; GO:0010628; P:positive regulation of gene expression; IBA:GO_Central.
GO; GO:0043123; P:positive regulation of I-kappaB kinase/NF-kappaB signaling; IBA:GO_Central.
InterPro; IPR000975; IL-1_fam.
InterPro; IPR003297; IL-1RA/IL-36.
InterPro; IPR008996; IL1/FGF.
PANTHER; PTHR10078; PTHR10078; 1.
Pfam; PF00340; IL1; 1.
PRINTS; PR00264; INTERLEUKIN1.
PRINTS; PR01360; INTRLEUKIN1X.
SUPFAM; SSF50353; SSF50353; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cytokine; Immunity;
Inflammatory response; Innate immunity; Polymorphism; Reference proteome;
Secreted.
PROPEP 1..17
/evidence="ECO:0000269|PubMed:21965679"
/id="PRO_0000430549"
CHAIN 18..169
/note="Interleukin-36 gamma"
/id="PRO_0000153648"
VAR_SEQ 19..54
/note="MCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPV -> I (in
isoform 2)"
/evidence="ECO:0000303|PubMed:12975309"
/id="VSP_013002"
VARIANT 69
/note="Q -> K (in dbSNP:rs6707930)"
/id="VAR_024505"
STRAND 23..29
/evidence="ECO:0000244|PDB:4IZE"
STRAND 33..38
/evidence="ECO:0000244|PDB:4IZE"
STRAND 41..46
/evidence="ECO:0000244|PDB:4IZE"
HELIX 47..49
/evidence="ECO:0000244|PDB:4IZE"
STRAND 55..60
/evidence="ECO:0000244|PDB:4IZE"
HELIX 64..66
/evidence="ECO:0000244|PDB:4P0L"
HELIX 69..71
/evidence="ECO:0000244|PDB:4P0L"
STRAND 73..80
/evidence="ECO:0000244|PDB:4IZE"
TURN 81..83
/evidence="ECO:0000244|PDB:4IZE"
STRAND 84..89
/evidence="ECO:0000244|PDB:4IZE"
STRAND 91..94
/evidence="ECO:0000244|PDB:4IZE"
STRAND 96..101
/evidence="ECO:0000244|PDB:4IZE"
HELIX 104..109
/evidence="ECO:0000244|PDB:4IZE"
STRAND 110..112
/evidence="ECO:0000244|PDB:4IZE"
HELIX 115..117
/evidence="ECO:0000244|PDB:4IZE"
STRAND 118..124
/evidence="ECO:0000244|PDB:4IZE"
STRAND 127..135
/evidence="ECO:0000244|PDB:4IZE"
STRAND 139..142
/evidence="ECO:0000244|PDB:4IZE"
STRAND 150..153
/evidence="ECO:0000244|PDB:4IZE"
STRAND 156..160
/evidence="ECO:0000244|PDB:4P0L"
STRAND 163..167
/evidence="ECO:0000244|PDB:4IZE"
SEQUENCE 169 AA; 18721 MW; F00A9243706F4154 CRC64;
MRGTPGDADG GGRAVYQSMC KPITGTINDL NQQVWTLQGQ NLVAVPRSDS VTPVTVAVIT
CKYPEALEQG RGDPIYLGIQ NPEMCLYCEK VGEQPTLQLK EQKIMDLYGQ PEPVKPFLFY
RAKTGRTSTL ESVAFPDWFI ASSKRDQPII LTSELGKSYN TAFELNIND


Related products :

Catalog number Product name Quantity
E2205h Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin-36 ga
E2205h ELISA Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin 96T
U2205h CLIA Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin- 96T
E2205h ELISA kit Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interl 96T
U2205h CLIA kit Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interle 96T
orb82722 Human IL1 RN protein Recombinant Human Interleukin-1 Receptor Antagonist is a member of the Interleukin-1cytokine family. IL1RN inhibits the activities of Interleukin-1 alpha (IL1A) and Interleukin-1 1 mg
26-207 IL1RAPL2 is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 0.05 mg
E2205m Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus
E2205m ELISA kit Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
U2205m CLIA kit Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
E2205m ELISA Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
U2205m CLIA Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
IL1F8 IL1F6 Gene interleukin 1 family, member 6 (epsilon)
E0066h ELISA kit CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 recepto 96T
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
U0065h CLIA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recepto 96T
E0065h ELISA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recept 96T
E0066h ELISA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor typ 96T
18-321-177008 INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6 - POLYCLONAL ANTIBODY TO MOUSE INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6; IL-6; Interleukin HP-1; B-cell hybridoma growth factor Polyclona 0.1 mg
CSB-EL011617HU Human interleukin 1 family, member 6 (epsilon) (IL1F6) ELISA kit, Species Human, Sample Type serum, plasma 96T
E2103h ELISA Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
E2103h ELISA kit Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
U2103h CLIA kit Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
U2103h CLIA Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
U0066h CLIA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type 96T
Pathways :
WP1840: Interleukin-3, 5 and GM-CSF signaling
WP2332: Interleukin-11 Signaling Pathway
WP1839: Interleukin-1 signaling
WP32: Translation Factors
WP1838: Interleukin-1 processing
WP537: Translation Factors
WP2199: Seed Development
WP2292: Chemokine signaling pathway
WP731: Sterol regulatory element binding protein related
WP2272: Pathogenic Escherichia coli infection
WP565: DNA Replication
WP1654: gamma-Hexachlorocyclohexane degradation
WP1909: Signal regulatory protein (SIRP) family interactions
WP1624: Bacterial secretion system
WP542: Electron Transport Chain
WP1049: G Protein Signaling Pathways
WP1689: Porphyrin and chlorophyll metabolism
WP2203: TSLP Signaling Pathway
WP1225: estrogen signalling
WP1693: Purine metabolism
WP1650: Fluorobenzoate degradation
WP1892: Protein folding
WP1659: Glycine, serine and threonine metabolism
WP1939: Unfolded Protein Response
WP813: G Protein Signaling Pathways

Related Genes :
[IL36G IL1E IL1F9 IL1H1 IL1RP2 UNQ2456/PRO5737] Interleukin-36 gamma (IL-1-related protein 2) (IL-1RP2) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 9) (IL-1F9) (Interleukin-1 homolog 1) (IL-1H1)
[Il36a Fil1e Il1e Il1f6 Il1h1] Interleukin-36 alpha (FIL1 epsilon) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 6) (IL-1F6) (Interleukin-1 homolog 1) (IL-1H1)
[IL36A FIL1E IL1E IL1F6] Interleukin-36 alpha (FIL1 epsilon) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 6) (IL-1F6)
[IL36RN FIL1D IL1F5 IL1HY1 IL1L1 IL1RP3 UNQ1896/PRO4342] Interleukin-36 receptor antagonist protein (IL-36Ra) (FIL1 delta) (IL-1-related protein 3) (IL-1RP3) (Interleukin-1 HY1) (IL-1HY1) (Interleukin-1 delta) (IL-1 delta) (Interleukin-1 family member 5) (IL-1F5) (Interleukin-1 receptor antagonist homolog 1) (IL-1ra homolog 1) (Interleukin-1-like protein 1) (IL-1L1)
[IL36RN Fil1d Il1f5 Il1h3 Il1hy1] Interleukin-36 receptor antagonist protein (IL-36Ra) (Interleukin-1 HY1) (IL-1HY1) (Interleukin-1 delta) (IL-1 delta) (Interleukin-1 family member 5) (IL-1F5) (Interleukin-1 homolog 3) (IL-1H3) (Interleukin-1-like protein 1) (IL-1L1)
[Il36g Il1f9] Interleukin-36 gamma (Interleukin-1 family member 9) (IL-1F9)
[IL37 FIL1Z IL1F7 IL1H4 IL1RP1] Interleukin-37 (FIL1 zeta) (IL-1X) (Interleukin-1 family member 7) (IL-1F7) (Interleukin-1 homolog 4) (IL-1H) (IL-1H4) (Interleukin-1 zeta) (IL-1 zeta) (Interleukin-1-related protein) (IL-1RP1) (Interleukin-23) (IL-37)
[IL36B IL1F8 IL1H2] Interleukin-36 beta (FIL1 eta) (Interleukin-1 eta) (IL-1 eta) (Interleukin-1 family member 8) (IL-1F8) (Interleukin-1 homolog 2) (IL-1H2)
[IL18R1 IL1RRP] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[IL33 C9orf26 IL1F11 NFHEV] Interleukin-33 (IL-33) (Interleukin-1 family member 11) (IL-1F11) (Nuclear factor from high endothelial venules) (NF-HEV) [Cleaved into: Interleukin-33 (95-270); Interleukin-33 (99-270); Interleukin-33 (109-270)]
[Il1r1 Il-1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL18RAP IL1R7] Interleukin-18 receptor accessory protein (IL-18 receptor accessory protein) (IL-18RAcP) (EC 3.2.2.6) (Accessory protein-like) (AcPL) (CD218 antigen-like family member B) (CDw218b) (IL-1R accessory protein-like) (IL-1RAcPL) (Interleukin-1 receptor 7) (IL-1R-7) (IL-1R7) (Interleukin-18 receptor accessory protein-like) (Interleukin-18 receptor beta) (IL-18R-beta) (IL-18Rbeta) (CD antigen CD218b)
[IL1R1 IL1R IL1RA IL1RT1] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[Il18r1] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[Il1rl2] Interleukin-1 receptor-like 2 (EC 3.2.2.6) (IL-36 receptor) (Interleukin-1 receptor-related protein 2) (IL-1Rrp2) (IL1R-rp2)
[Il1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IFNLR1 IL28RA LICR2] Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)
[IL1RAPL1 OPHN4] Interleukin-1 receptor accessory protein-like 1 (IL-1-RAPL-1) (IL-1RAPL-1) (IL1RAPL-1) (EC 3.2.2.6) (Oligophrenin-4) (Three immunoglobulin domain-containing IL-1 receptor-related 2) (TIGIRR-2) (X-linked interleukin-1 receptor accessory protein-like 1)
[IL17RB CRL4 EVI27 IL17BR UNQ2501/PRO19612] Interleukin-17 receptor B (IL-17 receptor B) (IL-17RB) (Cytokine receptor-like 4) (IL-17 receptor homolog 1) (IL-17Rh1) (IL17Rh1) (Interleukin-17B receptor) (IL-17B receptor)
[IL1RAP C3orf13 IL1R3] Interleukin-1 receptor accessory protein (IL-1 receptor accessory protein) (IL-1RAcP) (EC 3.2.2.6) (Interleukin-1 receptor 3) (IL-1R-3) (IL-1R3)
[IL18 IGIF IL1F4] Interleukin-18 (IL-18) (Iboctadekin) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
[Il18 Igif] Interleukin-18 (IL-18) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
[Il18 Igif] Interleukin-18 (IL-18) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
[IL18 IGIF] Interleukin-18 (IL-18) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
[IL18 IGIF] Interleukin-18 (IL-18) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
[IL18 IGIF] Interleukin-18 (IL-18) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
[IL4R IL4RA 582J2.1] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il11ra1 Etl2 Il11ra] Interleukin-11 receptor subunit alpha-1 (IL-11 receptor subunit alpha-1) (IL-11R subunit alpha-1) (IL-11R-alpha-1) (IL-11RA1) (Enhancer trap locus homolog 2) (Etl-2) (Novel cytokine receptor 1) (NR-1) (NR1)
[Il1rap] Interleukin-1 receptor accessory protein (IL-1 receptor accessory protein) (IL-1RAcP) (EC 3.2.2.6) (Interleukin-33 receptot beta chain)
[IL10RB CRFB4 D21S58 D21S66] Interleukin-10 receptor subunit beta (IL-10 receptor subunit beta) (IL-10R subunit beta) (IL-10RB) (Cytokine receptor class-II member 4) (Cytokine receptor family 2 member 4) (CRF2-4) (Interleukin-10 receptor subunit 2) (IL-10R subunit 2) (IL-10R2) (CD antigen CDw210b)

Bibliography :