GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5R-alpha) (IL-5RA) (CDw125) (CD antigen CD125)

 IL5RA_HUMAN             Reviewed;         420 AA.
Q01344; B3IU77; B4E2G0; Q14633; Q15469; Q6ISX9;
01-JUL-1993, integrated into UniProtKB/Swiss-Prot.
17-OCT-2006, sequence version 2.
12-AUG-2020, entry version 197.
RecName: Full=Interleukin-5 receptor subunit alpha;
Short=IL-5 receptor subunit alpha;
Short=IL-5R subunit alpha;
Short=IL-5R-alpha;
Short=IL-5RA;
AltName: Full=CDw125;
AltName: CD_antigen=CD125;
Flags: Precursor;
Name=IL5RA; Synonyms=IL5R;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
PubMed=1833065; DOI=10.1016/0092-8674(91)90040-6;
Tavernier J., Devos R., Cornelis S., Tuypens T., van der Heyden J.,
Fiers W., Plaetinck G.;
"A human high affinity interleukin-5 receptor (IL5R) is composed of an IL5-
specific alpha chain and a beta chain shared with the receptor for GM-
CSF.";
Cell 66:1175-1184(1991).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), AND VARIANT VAL-129.
TISSUE=Peripheral blood;
PubMed=1732409; DOI=10.1084/jem.175.2.341;
Murata Y., Takaki S., Migita M., Kikuchi Y., Tominaga A., Takatsu K.;
"Molecular cloning and expression of the human interleukin 5 receptor.";
J. Exp. Med. 175:341-351(1992).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3).
PubMed=1495999; DOI=10.1073/pnas.89.15.7041;
Tavernier J., Tuypens T., Plaetinck G., Verhee A., Fiers W., Devos R.;
"Molecular basis of the membrane-anchored and two soluble isoforms of the
human interleukin 5 receptor alpha subunit.";
Proc. Natl. Acad. Sci. U.S.A. 89:7041-7045(1992).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
Ishihara K., Yamada M., Hirasawa N., Ohuchi K.;
"Isolation of the variants for human interleukin-5 receptor alpha
subunit.";
Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
TISSUE=Trachea;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[6]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS VAL-129 AND ALA-262.
SeattleSNPs variation discovery resource;
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16641997; DOI=10.1038/nature04728;
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J.,
Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P.,
Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A.,
Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L.,
Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G.,
Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W.,
Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M.,
Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P.,
Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H.,
Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J.,
Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W.,
Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B.,
Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O.,
Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B.,
Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H.,
Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J.,
Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X.,
Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R.,
Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.;
"The DNA sequence, annotation and analysis of human chromosome 3.";
Nature 440:1194-1198(2006).
[8]
X-RAY CRYSTALLOGRAPHY (1.35 ANGSTROMS) OF 413-420 IN COMPLEX WITH SDCBP.
PubMed=12842047; DOI=10.1016/s0969-2126(03)00125-4;
Kang B.S., Cooper D.R., Devedjiev Y., Derewenda U., Derewenda Z.S.;
"Molecular roots of degenerate specificity in syntenin's PDZ2 domain:
reassessment of the PDZ recognition paradigm.";
Structure 11:845-853(2003).
[9]
X-RAY CRYSTALLOGRAPHY (2.55 ANGSTROMS) OF 20-332 IN COMPLEX WITH IL5, AND
DISULFIDE BONDS.
PubMed=22153509; DOI=10.1016/j.str.2011.08.015;
Patino E., Kotzsch A., Saremba S., Nickel J., Schmitz W., Sebald W.,
Mueller T.D.;
"Structure analysis of the IL-5 ligand-receptor complex reveals a wrench-
like architecture for IL-5Ralpha.";
Structure 19:1864-1875(2011).
-!- FUNCTION: This is the receptor for interleukin-5. The alpha chain binds
to IL5.
-!- SUBUNIT: Heterodimer of an alpha and a beta subunit. The beta subunit
is common to the IL3, IL5 and GM-CSF receptors. Interacts with SDCBP.
{ECO:0000269|PubMed:12842047, ECO:0000269|PubMed:22153509}.
-!- INTERACTION:
Q01344; P32927: CSF2RB; NbExp=3; IntAct=EBI-1759442, EBI-1809771;
Q01344; P05113: IL5; NbExp=2; IntAct=EBI-1759442, EBI-2435811;
Q01344; O60674: JAK2; NbExp=2; IntAct=EBI-1759442, EBI-518647;
Q01344-2; P05113: IL5; NbExp=4; IntAct=EBI-15957545, EBI-2435811;
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1; Synonyms=Membrane-bound;
IsoId=Q01344-1; Sequence=Displayed;
Name=2; Synonyms=Soluble-S1;
IsoId=Q01344-2; Sequence=VSP_001678, VSP_001679;
Name=3; Synonyms=Soluble-S2;
IsoId=Q01344-3; Sequence=VSP_001680, VSP_001681;
Name=4;
IsoId=Q01344-4; Sequence=VSP_046742;
Name=5;
IsoId=Q01344-5; Sequence=VSP_047762;
-!- TISSUE SPECIFICITY: Expressed on eosinophils and basophils.
-!- DOMAIN: The WSXWS motif appears to be necessary for proper protein
folding and thereby efficient intracellular transport and cell-surface
receptor binding.
-!- DOMAIN: The box 1 motif is required for JAK interaction and/or
activation.
-!- SIMILARITY: Belongs to the type I cytokine receptor family. Type 5
subfamily. {ECO:0000305}.
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il5ra/";
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; M75914; AAA36110.1; -; mRNA.
EMBL; X61176; CAA43483.1; -; mRNA.
EMBL; X62156; CAA44081.1; -; mRNA.
EMBL; M96651; AAA59151.1; -; mRNA.
EMBL; M96652; AAA59152.1; -; mRNA.
EMBL; AB288090; BAG49562.1; -; mRNA.
EMBL; AK304256; BAG65122.1; -; mRNA.
EMBL; AY642135; AAT45457.1; -; Genomic_DNA.
EMBL; AC022002; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC024060; -; NOT_ANNOTATED_CDS; Genomic_DNA.
CCDS; CCDS2559.1; -. [Q01344-1]
CCDS; CCDS2560.1; -. [Q01344-2]
CCDS; CCDS46739.1; -. [Q01344-3]
CCDS; CCDS58813.1; -. [Q01344-4]
PIR; A40267; A40267.
RefSeq; NP_000555.2; NM_000564.4. [Q01344-1]
RefSeq; NP_001230028.1; NM_001243099.1. [Q01344-4]
RefSeq; NP_783851.1; NM_175724.2. [Q01344-3]
RefSeq; NP_783852.1; NM_175725.2. [Q01344-2]
RefSeq; NP_783853.1; NM_175726.3. [Q01344-1]
RefSeq; NP_783854.1; NM_175727.2. [Q01344-3]
RefSeq; NP_783855.1; NM_175728.2. [Q01344-2]
PDB; 1OBX; X-ray; 1.35 A; B=413-420.
PDB; 1OBZ; X-ray; 1.69 A; P=413-420.
PDB; 3QT2; X-ray; 2.55 A; A/B=20-335.
PDB; 3VA2; X-ray; 2.70 A; C=21-335.
PDB; 6H41; X-ray; 2.75 A; A=27-332.
PDBsum; 1OBX; -.
PDBsum; 1OBZ; -.
PDBsum; 3QT2; -.
PDBsum; 3VA2; -.
PDBsum; 6H41; -.
SMR; Q01344; -.
BioGRID; 109782; 17.
DIP; DIP-3510N; -.
ELM; Q01344; -.
IntAct; Q01344; 5.
STRING; 9606.ENSP00000412209; -.
ChEMBL; CHEMBL3580483; -.
DrugBank; DB12023; Benralizumab.
DrugCentral; Q01344; -.
GuidetoPHARMACOLOGY; 1706; -.
GlyGen; Q01344; 4 sites.
iPTMnet; Q01344; -.
PhosphoSitePlus; Q01344; -.
BioMuta; IL5RA; -.
DMDM; 116242525; -.
MassIVE; Q01344; -.
MaxQB; Q01344; -.
PaxDb; Q01344; -.
PeptideAtlas; Q01344; -.
PRIDE; Q01344; -.
ProteomicsDB; 3479; -.
ProteomicsDB; 57939; -. [Q01344-1]
ProteomicsDB; 57940; -. [Q01344-2]
ProteomicsDB; 57941; -. [Q01344-3]
ProteomicsDB; 5815; -.
ABCD; Q01344; 1 sequenced antibody.
Antibodypedia; 2274; 383 antibodies.
Ensembl; ENST00000256452; ENSP00000256452; ENSG00000091181. [Q01344-1]
Ensembl; ENST00000311981; ENSP00000309196; ENSG00000091181. [Q01344-2]
Ensembl; ENST00000383846; ENSP00000373358; ENSG00000091181. [Q01344-2]
Ensembl; ENST00000430514; ENSP00000400400; ENSG00000091181. [Q01344-3]
Ensembl; ENST00000438560; ENSP00000390753; ENSG00000091181. [Q01344-4]
Ensembl; ENST00000446632; ENSP00000412209; ENSG00000091181. [Q01344-1]
Ensembl; ENST00000456302; ENSP00000392059; ENSG00000091181. [Q01344-3]
GeneID; 3568; -.
KEGG; hsa:3568; -.
UCSC; uc010hbs.4; human. [Q01344-1]
CTD; 3568; -.
DisGeNET; 3568; -.
EuPathDB; HostDB:ENSG00000091181.19; -.
GeneCards; IL5RA; -.
HGNC; HGNC:6017; IL5RA.
HPA; ENSG00000091181; Tissue enhanced (blood, fallopian tube).
MIM; 147851; gene.
neXtProt; NX_Q01344; -.
OpenTargets; ENSG00000091181; -.
PharmGKB; PA29834; -.
eggNOG; ENOG502QZNV; Eukaryota.
GeneTree; ENSGT00940000160890; -.
HOGENOM; CLU_039945_0_0_1; -.
InParanoid; Q01344; -.
KO; K05067; -.
OMA; HAIDQVN; -.
OrthoDB; 1151666at2759; -.
PhylomeDB; Q01344; -.
TreeFam; TF331549; -.
PathwayCommons; Q01344; -.
Reactome; R-HSA-512988; Interleukin-3, Interleukin-5 and GM-CSF signaling.
Reactome; R-HSA-5673001; RAF/MAP kinase cascade.
Reactome; R-HSA-912526; Interleukin receptor SHC signaling.
SignaLink; Q01344; -.
SIGNOR; Q01344; -.
BioGRID-ORCS; 3568; 2 hits in 868 CRISPR screens.
ChiTaRS; IL5RA; human.
EvolutionaryTrace; Q01344; -.
GeneWiki; Interleukin_5_receptor_alpha_subunit; -.
GenomeRNAi; 3568; -.
Pharos; Q01344; Tclin.
PRO; PR:Q01344; -.
Proteomes; UP000005640; Chromosome 3.
RNAct; Q01344; protein.
Bgee; ENSG00000091181; Expressed in right uterine tube and 108 other tissues.
ExpressionAtlas; Q01344; baseline and differential.
Genevisible; Q01344; HS.
GO; GO:0009897; C:external side of plasma membrane; IBA:GO_Central.
GO; GO:0005615; C:extracellular space; TAS:ProtInc.
GO; GO:0016021; C:integral component of membrane; TAS:ProtInc.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0043235; C:receptor complex; IBA:GO_Central.
GO; GO:0019955; F:cytokine binding; IBA:GO_Central.
GO; GO:0004896; F:cytokine receptor activity; IBA:GO_Central.
GO; GO:0004914; F:interleukin-5 receptor activity; TAS:ProtInc.
GO; GO:0019221; P:cytokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0002437; P:inflammatory response to antigenic stimulus; IEA:Ensembl.
GO; GO:0000165; P:MAPK cascade; TAS:Reactome.
GO; GO:0070665; P:positive regulation of leukocyte proliferation; TAS:GO_Central.
GO; GO:0032674; P:regulation of interleukin-5 production; IEA:Ensembl.
GO; GO:0007165; P:signal transduction; TAS:ProtInc.
Gene3D; 2.60.40.10; -; 3.
InterPro; IPR003961; FN3_dom.
InterPro; IPR036116; FN3_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003532; Short_hematopoietin_rcpt_2_CS.
InterPro; IPR015321; TypeI_recpt_CBD.
Pfam; PF09240; IL6Ra-bind; 1.
SUPFAM; SSF49265; SSF49265; 2.
PROSITE; PS50853; FN3; 2.
PROSITE; PS01356; HEMATOPO_REC_S_F2; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Disulfide bond; Glycoprotein; Membrane;
Polymorphism; Receptor; Reference proteome; Repeat; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1..20
CHAIN 21..420
/note="Interleukin-5 receptor subunit alpha"
/id="PRO_0000010893"
TOPO_DOM 21..342
/note="Extracellular"
/evidence="ECO:0000255"
TRANSMEM 343..362
/note="Helical"
/evidence="ECO:0000255"
TOPO_DOM 363..420
/note="Cytoplasmic"
/evidence="ECO:0000255"
DOMAIN 32..123
/note="Fibronectin type-III 1"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
DOMAIN 241..334
/note="Fibronectin type-III 2"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
MOTIF 322..326
/note="WSXWS motif"
MOTIF 371..379
/note="Box 1 motif"
CARBOHYD 35
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 131
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 216
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 244
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
DISULFID 134..155
/evidence="ECO:0000269|PubMed:22153509"
DISULFID 182..196
/evidence="ECO:0000269|PubMed:22153509"
DISULFID 269..316
/evidence="ECO:0000269|PubMed:22153509"
VAR_SEQ 123..331
/note="Missing (in isoform 5)"
/evidence="ECO:0000303|Ref.4"
/id="VSP_047762"
VAR_SEQ 333..335
/note="NDE -> FSR (in isoform 2)"
/evidence="ECO:0000303|PubMed:1833065"
/id="VSP_001678"
VAR_SEQ 333
/note="N -> K (in isoform 3)"
/evidence="ECO:0000303|PubMed:1495999,
ECO:0000303|PubMed:1732409"
/id="VSP_001680"
VAR_SEQ 334..420
/note="Missing (in isoform 3)"
/evidence="ECO:0000303|PubMed:1495999,
ECO:0000303|PubMed:1732409"
/id="VSP_001681"
VAR_SEQ 336..420
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:1833065"
/id="VSP_001679"
VAR_SEQ 365..420
/note="CHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLE
DSVF -> KLGPVRRKLKSSVI (in isoform 4)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_046742"
VARIANT 129
/note="I -> V (in dbSNP:rs2290610)"
/evidence="ECO:0000269|PubMed:1732409, ECO:0000269|Ref.6"
/id="VAR_020654"
VARIANT 262
/note="V -> A (in dbSNP:rs17879690)"
/evidence="ECO:0000269|Ref.6"
/id="VAR_020655"
CONFLICT 212
/note="A -> S (in Ref. 1; AAA36110 and 2; AAA59151/
AAA59152)"
/evidence="ECO:0000305"
STRAND 34..42
/evidence="ECO:0000244|PDB:3QT2"
STRAND 45..51
/evidence="ECO:0000244|PDB:3QT2"
STRAND 54..56
/evidence="ECO:0000244|PDB:6H41"
STRAND 59..61
/evidence="ECO:0000244|PDB:3QT2"
STRAND 64..73
/evidence="ECO:0000244|PDB:3QT2"
STRAND 75..87
/evidence="ECO:0000244|PDB:3QT2"
STRAND 94..103
/evidence="ECO:0000244|PDB:3QT2"
STRAND 108..110
/evidence="ECO:0000244|PDB:3QT2"
STRAND 114..118
/evidence="ECO:0000244|PDB:3QT2"
STRAND 122..124
/evidence="ECO:0000244|PDB:3VA2"
HELIX 125..127
/evidence="ECO:0000244|PDB:3QT2"
STRAND 130..140
/evidence="ECO:0000244|PDB:3QT2"
STRAND 144..146
/evidence="ECO:0000244|PDB:3QT2"
STRAND 149..158
/evidence="ECO:0000244|PDB:3QT2"
STRAND 168..175
/evidence="ECO:0000244|PDB:3QT2"
STRAND 178..181
/evidence="ECO:0000244|PDB:3QT2"
STRAND 185..187
/evidence="ECO:0000244|PDB:3QT2"
STRAND 189..191
/evidence="ECO:0000244|PDB:6H41"
STRAND 193..200
/evidence="ECO:0000244|PDB:3QT2"
STRAND 209..218
/evidence="ECO:0000244|PDB:3QT2"
STRAND 220..222
/evidence="ECO:0000244|PDB:6H41"
STRAND 227..232
/evidence="ECO:0000244|PDB:3QT2"
HELIX 233..236
/evidence="ECO:0000244|PDB:3QT2"
STRAND 243..250
/evidence="ECO:0000244|PDB:3QT2"
STRAND 253..259
/evidence="ECO:0000244|PDB:3QT2"
STRAND 262..265
/evidence="ECO:0000244|PDB:3QT2"
HELIX 267..269
/evidence="ECO:0000244|PDB:3QT2"
STRAND 270..278
/evidence="ECO:0000244|PDB:3QT2"
TURN 279..281
/evidence="ECO:0000244|PDB:3QT2"
STRAND 284..297
/evidence="ECO:0000244|PDB:3QT2"
STRAND 304..312
/evidence="ECO:0000244|PDB:3QT2"
TURN 314..316
/evidence="ECO:0000244|PDB:3QT2"
STRAND 329..331
/evidence="ECO:0000244|PDB:3QT2"
SEQUENCE 420 AA; 47685 MW; 4E0A5F2838B9C4FE CRC64;
MIIVAHVLLI LLGATEILQA DLLPDEKISL LPPVNFTIKV TGLAQVLLQW KPNPDQEQRN
VNLEYQVKIN APKEDDYETR ITESKCVTIL HKGFSASVRT ILQNDHSLLA SSWASAELHA
PPGSPGTSIV NLTCTTNTTE DNYSRLRSYQ VSLHCTWLVG TDAPEDTQYF LYYRYGSWTE
ECQEYSKDTL GRNIACWFPR TFILSKGRDW LAVLVNGSSK HSAIRPFDQL FALHAIDQIN
PPLNVTAEIE GTRLSIQWEK PVSAFPIHCF DYEVKIHNTR NGYLQIEKLM TNAFISIIDD
LSKYDVQVRA AVSSMCREAG LWSEWSQPIY VGNDEHKPLR EWFVIVIMAT ICFILLILSL
ICKICHLWIK LFPPIPAPKS NIKDLFVTTN YEKAGSSETE IEVICYIEKP GVETLEDSVF


Related products :

Catalog number Product name Quantity
E0229h ELISA Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U0229h CLIA Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229h ELISA kit Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E1815h ELISA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
U1815h CLIA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
U1815h CLIA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E2031h ELISA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E2031h ELISA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031h CLIA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031h CLIA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E0229b ELISA kit Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229b ELISA Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U0229b CLIA Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E2031m ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
U2031r CLIA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
E2031m ELISA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
E1815r ELISA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815m CLIA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
U1815r CLIA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
E2031r ELISA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
E1815r ELISA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815m CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
E2031r ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815r CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
Pathways :
WP1566: Citrate cycle (TCA cycle)
WP1614: 1- and 2-Methylnaphthalene degradation
WP1655: Geraniol degradation
WP1963: The effect of Glucocorticoids on target gene expression
WP566: canonical wnt - zebrafish
WP2272: Pathogenic Escherichia coli infection
WP2292: Chemokine signaling pathway
WP1618: alpha-Linolenic acid metabolism
WP219: Cytoplasmic tRNA Synthetases
WP457: TNF-alpha NF-kB Signaling Pathway
WP1003: Ovarian Infertility Genes
WP262: EBV LMP1 signaling
WP537: Translation Factors
WP1369: TNF-alpha NF-kB Signaling Pathway
WP231: TNF alpha Signaling Pathway
WP811: TNF-alpha NF-kB Signaling Pathway
WP1225: estrogen signalling
WP34: Ovarian Infertility Genes
WP2100: AhR pathway
WP402: ERK1 - ERK2 MAPK cascade
WP246: TNF-alpha NF-kB Signaling Pathway
WP1835: Interferon alpha/beta signaling
WP773: Ovarian Infertility Genes
WP215: noncanonical wnt pathway
WP2199: Seed Development

Related Genes :
[IL5RA IL5R] Interleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5R-alpha) (IL-5RA) (CDw125) (CD antigen CD125)
[Il5ra Il5r] Interleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5R-alpha) (IL-5RA) (CD antigen CD125)
[IL13RA1 IL13R IL13RA] Interleukin-13 receptor subunit alpha-1 (IL-13 receptor subunit alpha-1) (IL-13R subunit alpha-1) (IL-13R-alpha-1) (IL-13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1)
[IL4R IL4RA 582J2.1] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[IL6R] Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126) [Cleaved into: Soluble interleukin-6 receptor subunit alpha (sIL6R)]
[IL7R] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CDw127) (CD antigen CD127)
[IL10RA IL10R] Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)
[IL15RA] Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]
[Il3ra Sut-1] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (Interleukin-3 receptor class II alpha chain) (CD antigen CD123)
[IL3RA IL3R] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (CD antigen CD123)
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124)
[IL13RA2 IL13R] Interleukin-13 receptor subunit alpha-2 (IL-13 receptor subunit alpha-2) (IL-13R subunit alpha-2) (IL-13R-alpha-2) (IL-13RA2) (Interleukin-13-binding protein) (CD antigen CD213a2)
[Il7r] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CD antigen CD127)
[IL1R1 IL1R IL1RA IL1RT1] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL6ST] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (CDw130) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il1r1 Il-1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL31RA CRL3 GPL UNQ6368/PRO21073/PRO21384] Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)
[IFNLR1 IL28RA LICR2] Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)
[IL18R1 IL1RRP] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[Il1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il11ra1 Etl2 Il11ra] Interleukin-11 receptor subunit alpha-1 (IL-11 receptor subunit alpha-1) (IL-11R subunit alpha-1) (IL-11R-alpha-1) (IL-11RA1) (Enhancer trap locus homolog 2) (Etl-2) (Novel cytokine receptor 1) (NR-1) (NR1) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]
[IL11RA] Interleukin-11 receptor subunit alpha (IL-11 receptor subunit alpha) (IL-11R subunit alpha) (IL-11R-alpha) (IL-11RA) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]
[IL2RB IL15RB] Interleukin-2 receptor subunit beta (IL-2 receptor subunit beta) (IL-2R subunit beta) (IL-2RB) (High affinity IL-2 receptor subunit beta) (Interleukin-15 receptor subunit beta) (p70-75) (p75) (CD antigen CD122)
[Il18r1] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[IL27RA CRL1 TCCR WSX1 UNQ296/PRO336] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoR1)
[CSF2RB IL3RB IL5RB] Cytokine receptor common subunit beta (CDw131) (GM-CSF/IL-3/IL-5 receptor common beta subunit) (CD antigen CD131)
[Il27ra Tccr Wsx1] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Type I T-cell cytokine receptor) (TCCR) (WSX-1)

Bibliography :