GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (CD antigen CD126)

 IL6RA_RAT               Reviewed;         462 AA.
P22273;
01-AUG-1991, integrated into UniProtKB/Swiss-Prot.
01-FEB-1995, sequence version 2.
26-FEB-2020, entry version 151.
RecName: Full=Interleukin-6 receptor subunit alpha;
Short=IL-6 receptor subunit alpha;
Short=IL-6R subunit alpha;
Short=IL-6R-alpha;
Short=IL-6RA;
AltName: Full=IL-6R 1;
AltName: CD_antigen=CD126;
Flags: Precursor;
Name=Il6r; Synonyms=Il6ra;
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA].
STRAIN=Fischer 344; TISSUE=Liver;
PubMed=2174054;
Baumann M., Baumann H., Fey G.H.;
"Molecular cloning, characterization and functional expression of the rat
liver interleukin 6 receptor.";
J. Biol. Chem. 265:19853-19862(1990).
[2]
IDENTIFICATION OF PROBABLE FRAMESHIFT IN 227-261.
Gibson T.;
Unpublished observations (FEB-1995).
-!- FUNCTION: Part of the receptor for interleukin 6. Binds to IL6 with low
affinity, but does not transduce a signal. Signal activation
necessitate an association with IL6ST. Activation may lead to the
regulation of the immune response, acute-phase reactions and
hematopoiesis.
-!- SUBUNIT: Hexamer of two molecules each of IL6, IL6R and IL6ST (By
similarity). Interacts (via N-terminal ectodomain) with SORL1; this
interaction may affect IL6-binding to IL6R, hence decrease IL6 cis-
signaling (By similarity). The soluble form of IL6R also interacts with
SORL1; this interaction leads to IL6R internalization (By similarity).
May form a trimeric complex with the soluble SORL1 ectodomain and
circulating IL6 receptor; this interaction might stabilize circulating
IL6, hence promote IL6 trans signaling (By similarity).
{ECO:0000250|UniProtKB:P08887}.
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein.
-!- DOMAIN: The two fibronectin type-III-like domains contained in the C-
terminal part form together a cytokine-binding domain.
-!- DOMAIN: The WSXWS motif appears to be necessary for proper protein
folding and thereby efficient intracellular transport and cell-surface
receptor binding.
-!- SIMILARITY: Belongs to the type I cytokine receptor family. Type 3
subfamily. {ECO:0000305}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; M58587; AAA41431.1; -; mRNA.
PIR; A37986; A37986.
STRING; 10116.ENSRNOP00000028234; -.
BindingDB; P22273; -.
ChEMBL; CHEMBL4289; -.
PaxDb; P22273; -.
PRIDE; P22273; -.
UCSC; RGD:2902; rat.
RGD; 2902; Il6r.
eggNOG; ENOG410II5K; Eukaryota.
eggNOG; ENOG4111XGC; LUCA.
InParanoid; P22273; -.
PhylomeDB; P22273; -.
Reactome; R-RNO-1059683; Interleukin-6 signaling.
Reactome; R-RNO-110056; MAPK3 (ERK1) activation.
Reactome; R-RNO-112411; MAPK1 (ERK2) activation.
PRO; PR:P22273; -.
Proteomes; UP000002494; Unplaced.
GO; GO:0016324; C:apical plasma membrane; ISO:RGD.
GO; GO:0009986; C:cell surface; ISO:RGD.
GO; GO:0070110; C:ciliary neurotrophic factor receptor complex; ISO:RGD.
GO; GO:0009897; C:external side of plasma membrane; IBA:GO_Central.
GO; GO:0005576; C:extracellular region; ISO:RGD.
GO; GO:0005615; C:extracellular space; IDA:RGD.
GO; GO:0005896; C:interleukin-6 receptor complex; ISO:RGD.
GO; GO:0032809; C:neuronal cell body membrane; IDA:RGD.
GO; GO:0043235; C:receptor complex; IBA:GO_Central.
GO; GO:0070119; F:ciliary neurotrophic factor binding; ISO:RGD.
GO; GO:0019955; F:cytokine binding; IBA:GO_Central.
GO; GO:0004896; F:cytokine receptor activity; IBA:GO_Central.
GO; GO:0019899; F:enzyme binding; ISO:RGD.
GO; GO:0019981; F:interleukin-6 binding; ISO:RGD.
GO; GO:0004915; F:interleukin-6 receptor activity; ISO:RGD.
GO; GO:0042803; F:protein homodimerization activity; ISO:RGD.
GO; GO:0070120; P:ciliary neurotrophic factor-mediated signaling pathway; ISO:RGD.
GO; GO:0019221; P:cytokine-mediated signaling pathway; ISO:RGD.
GO; GO:0048589; P:developmental growth; IMP:RGD.
GO; GO:0031018; P:endocrine pancreas development; ISO:RGD.
GO; GO:0070102; P:interleukin-6-mediated signaling pathway; ISO:RGD.
GO; GO:0032966; P:negative regulation of collagen biosynthetic process; ISO:RGD.
GO; GO:0010536; P:positive regulation of activation of Janus kinase activity; ISO:RGD.
GO; GO:0008284; P:positive regulation of cell population proliferation; IMP:RGD.
GO; GO:0032722; P:positive regulation of chemokine production; ISO:RGD.
GO; GO:0072126; P:positive regulation of glomerular mesangial cell proliferation; ISO:RGD.
GO; GO:0032755; P:positive regulation of interleukin-6 production; ISO:RGD.
GO; GO:0043410; P:positive regulation of MAPK cascade; ISO:RGD.
GO; GO:0050731; P:positive regulation of peptidyl-tyrosine phosphorylation; ISO:RGD.
GO; GO:0048661; P:positive regulation of smooth muscle cell proliferation; ISO:RGD.
GO; GO:0042531; P:positive regulation of tyrosine phosphorylation of STAT protein; ISO:RGD.
GO; GO:0051591; P:response to cAMP; IEP:RGD.
GO; GO:0034097; P:response to cytokine; ISO:RGD.
GO; GO:0045471; P:response to ethanol; IEP:RGD.
GO; GO:0010332; P:response to gamma radiation; IEP:RGD.
GO; GO:0051384; P:response to glucocorticoid; IEP:RGD.
GO; GO:0032496; P:response to lipopolysaccharide; IEP:RGD.
GO; GO:0043434; P:response to peptide hormone; IEP:RGD.
CDD; cd00063; FN3; 1.
Gene3D; 2.60.40.10; -; 3.
InterPro; IPR003961; FN3_dom.
InterPro; IPR036116; FN3_sf.
InterPro; IPR003530; Hematopoietin_rcpt_L_F3_CS.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
InterPro; IPR003598; Ig_sub2.
InterPro; IPR013151; Immunoglobulin.
InterPro; IPR015321; TypeI_recpt_CBD.
Pfam; PF00047; ig; 1.
Pfam; PF09240; IL6Ra-bind; 1.
SMART; SM00409; IG; 1.
SMART; SM00408; IGc2; 1.
SUPFAM; SSF48726; SSF48726; 1.
SUPFAM; SSF49265; SSF49265; 2.
PROSITE; PS50853; FN3; 1.
PROSITE; PS01354; HEMATOPO_REC_L_F3; 1.
PROSITE; PS50835; IG_LIKE; 1.
2: Evidence at transcript level;
Disulfide bond; Glycoprotein; Immunoglobulin domain; Membrane; Receptor;
Reference proteome; Signal; Transmembrane; Transmembrane helix.
SIGNAL 1..19
CHAIN 20..462
/note="Interleukin-6 receptor subunit alpha"
/id="PRO_0000010898"
TOPO_DOM 20..364
/note="Extracellular"
/evidence="ECO:0000255"
TRANSMEM 365..385
/note="Helical"
/evidence="ECO:0000255"
TOPO_DOM 386..462
/note="Cytoplasmic"
/evidence="ECO:0000255"
DOMAIN 20..108
/note="Ig-like C2-type"
DOMAIN 215..313
/note="Fibronectin type-III"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
MOTIF 300..304
/note="WSXWS motif"
COMPBIAS 404..408
/note="Poly-Pro"
CARBOHYD 32
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 55
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 85
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 150
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
DISULFID 25..190
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
DISULFID 47..92
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
DISULFID 117..128
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
DISULFID 162..173
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
CONFLICT 227..261
/note="XPRWLKVSWQDPESWDPSYYLLQFELRYRPVWSKX -> SLVGSKSVGKTLS
PGTQVTTCCNSSFDTDLYGQRT (in Ref. 1; AAA41431)"
/evidence="ECO:0000305"
SEQUENCE 462 AA; 50401 MW; A4D6064CEDC0537D CRC64;
MLAVGCTLLV ALLAAPAVAL VLGSCRALEV ANGTVTSLPG ATVTLICPGK EAAGNATIHW
VYSGSQSREW TTTGNTLVLR AVQVNDTGHY LCFLDDHLVG TVPLLVDVPP EEPKLSCFRK
NPLVNAFCEW HPSSTPSPTT KAVMFAKKIN TTNGKSDFQV PCQYSQQLKS FSCEVEILEG
DKVYHIVSLC VANSVGSRSS HNVVFQSLKM VQPDPPANLV VSAIPGXPRW LKVSWQDPES
WDPSYYLLQF ELRYRPVWSK XFTVWPLQVA QHQCVIHDAL RGVKHVVQVR GKEEFDIGQW
SKWSPEVTGT PWLAEPRTTP AGIPGNPTQV SVEDYDNHED QYGSSTEATS VLAPVQGSSP
IPLPTFLVAG GSLAFGLLLC VFIILRLKKK WKSQAEKESK TTSPPPYPLG PLKPTFLLVP
LLTPSGSHNS SGTDNTGSHS CLGVRDPQCP NDNSNRDYLF PR


Related products :

Catalog number Product name Quantity
U0229h CLIA Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229h ELISA Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229h ELISA kit Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U1815h CLIA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
U1815h CLIA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
U2031h CLIA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E2031h ELISA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031h CLIA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E2031h ELISA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E0229b ELISA Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229b ELISA kit Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U0229b CLIA Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E1815r ELISA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815m CLIA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
U2031m CLIA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
E1815m ELISA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
U1815r CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
U2031r CLIA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
U2031m CLIA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
E1815m ELISA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
U1815m CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
E2031m ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
E1815r ELISA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
Pathways :
WP1566: Citrate cycle (TCA cycle)
WP1614: 1- and 2-Methylnaphthalene degradation
WP1655: Geraniol degradation
WP1963: The effect of Glucocorticoids on target gene expression
WP566: canonical wnt - zebrafish
WP2272: Pathogenic Escherichia coli infection
WP2292: Chemokine signaling pathway
WP1618: alpha-Linolenic acid metabolism
WP219: Cytoplasmic tRNA Synthetases
WP457: TNF-alpha NF-kB Signaling Pathway
WP1003: Ovarian Infertility Genes
WP262: EBV LMP1 signaling
WP1369: TNF-alpha NF-kB Signaling Pathway
WP537: Translation Factors
WP1225: estrogen signalling
WP231: TNF alpha Signaling Pathway
WP811: TNF-alpha NF-kB Signaling Pathway
WP34: Ovarian Infertility Genes
WP246: TNF-alpha NF-kB Signaling Pathway
WP2100: AhR pathway
WP402: ERK1 - ERK2 MAPK cascade
WP215: noncanonical wnt pathway
WP1835: Interferon alpha/beta signaling
WP773: Ovarian Infertility Genes
WP273: Ovarian Infertility Genes

Related Genes :
[IL6R] Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[IL6ST] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (CDw130) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il3ra Sut-1] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (Interleukin-3 receptor class II alpha chain) (CD antigen CD123)
[IL13RA1 IL13R IL13RA] Interleukin-13 receptor subunit alpha-1 (IL-13 receptor subunit alpha-1) (IL-13R subunit alpha-1) (IL-13R-alpha-1) (IL-13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1)
[IL4R IL4RA 582J2.1] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il7r] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CD antigen CD127)
[IL1R1 IL1R IL1RA IL1RT1] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[Il1r1 Il-1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[Il11ra1 Etl2 Il11ra] Interleukin-11 receptor subunit alpha-1 (IL-11 receptor subunit alpha-1) (IL-11R subunit alpha-1) (IL-11R-alpha-1) (IL-11RA1) (Enhancer trap locus homolog 2) (Etl-2) (Novel cytokine receptor 1) (NR-1) (NR1)
[IL18R1 IL1RRP] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[IL10RA IL10R] Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)
[Il1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL3RA IL3R] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (CD antigen CD123)
[IL7R] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CDw127) (CD antigen CD127)
[IL13RA2 IL13R] Interleukin-13 receptor subunit alpha-2 (IL-13 receptor subunit alpha-2) (IL-13R subunit alpha-2) (IL-13R-alpha-2) (IL-13RA2) (Interleukin-13-binding protein) (CD antigen CD213a2)
[IL5RA IL5R] Interleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5R-alpha) (IL-5RA) (CDw125) (CD antigen CD125)
[Il27ra Tccr Wsx1] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Type I T-cell cytokine receptor) (TCCR) (WSX-1)
[IL15RA] Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]
[IL31RA CRL3 GPL UNQ6368/PRO21073/PRO21384] Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)
[Il18r1] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124)
[IFNLR1 IL28RA LICR2] Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)
[IL27RA CRL1 TCCR WSX1 UNQ296/PRO336] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoR1)
[IL11RA] Interleukin-11 receptor subunit alpha (IL-11 receptor subunit alpha) (IL-11R subunit alpha) (IL-11R-alpha) (IL-11RA)
[Il2rg] Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)
[Il12rb1 Il12rb] Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12 receptor beta component) (CD antigen CD212)
[IL18RAP IL1R7] Interleukin-18 receptor accessory protein (IL-18 receptor accessory protein) (IL-18RAcP) (EC 3.2.2.6) (Accessory protein-like) (AcPL) (CD218 antigen-like family member B) (CDw218b) (IL-1R accessory protein-like) (IL-1RAcPL) (Interleukin-1 receptor 7) (IL-1R-7) (IL-1R7) (Interleukin-18 receptor accessory protein-like) (Interleukin-18 receptor beta) (IL-18R-beta) (IL-18Rbeta) (CD antigen CD218b)

Bibliography :