GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Low affinity immunoglobulin gamma Fc region receptor II (Fc gamma receptor IIB) (Fc-gamma RII) (Fc-gamma-RIIB) (FcRII) (IgG Fc receptor II beta) (Lymphocyte antigen 17) (Ly-17) (CD antigen CD32)

 FCGR2_MOUSE             Reviewed;         330 AA.
P08101; P08102; P12316; P97917; Q60938; Q60939; Q60940; Q61170; Q61558;
01-AUG-1988, integrated into UniProtKB/Swiss-Prot.
01-NOV-1997, sequence version 2.
07-APR-2021, entry version 187.
RecName: Full=Low affinity immunoglobulin gamma Fc region receptor II;
AltName: Full=Fc gamma receptor IIB;
Short=Fc-gamma RII;
Short=Fc-gamma-RIIB;
Short=FcRII;
AltName: Full=IgG Fc receptor II beta;
AltName: Full=Lymphocyte antigen 17;
Short=Ly-17;
AltName: CD_antigen=CD32;
Flags: Precursor;
Name=Fcgr2; Synonyms=Fcgr2b, Ly-17;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA], AND PROTEIN SEQUENCE OF 30-51 (ISOFORMS IIB1
AND IIB2).
PubMed=2946078; DOI=10.1126/science.2946078;
Ravetch J.V., Luster A.D., Weinshank R., Kochan J., Pavlovec A.,
Portnoy D.A., Hulmes J., Pan Y.-C.E., Unkeless J.C.;
"Structural heterogeneity and functional domains of murine immunoglobulin G
Fc receptors.";
Science 234:718-725(1986).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB2).
TISSUE=Macrophage;
PubMed=3024012; DOI=10.1038/324372a0;
Lewis V.A., Koch T., Plutner H., Mellman I.;
"A complementary DNA clone for a macrophage-lymphocyte Fc receptor.";
Nature 324:372-375(1986).
[3]
NUCLEOTIDE SEQUENCE [MRNA], AND PARTIAL PROTEIN SEQUENCE (ISOFORM IIB1).
PubMed=2957319; DOI=10.1007/bf00365906;
Hogarth P.M., Hibbs M.L., Bonadonna L., Scott B.M., Witort E.,
Pietersz G.A., McKenzie I.F.C.;
"The mouse Fc receptor for IgG (Ly-17): molecular cloning and
specificity.";
Immunogenetics 26:161-168(1987).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM IIB1), POLYMORPHISM, AND
VARIANTS.
STRAIN=BALB/cJ; TISSUE=Spleen;
PubMed=2138587; DOI=10.1007/bf00211557;
Lah M., Quelch K., Deacon N.J., McKenzie I.F., Hogarth P.M.;
"Identification of the mouse beta Fc gamma RII polymorphism by direct
sequencing of amplified genomic DNA.";
Immunogenetics 31:202-206(1990).
[5]
NUCLEOTIDE SEQUENCE (ISOFORMS IIB1 AND IIB2).
PubMed=1824594;
Hogarth P.M., Witort E., Hulett M.D., Bonnerot C., Even J., Fridman W.H.,
McKenzie I.F.C.;
"Structure of the mouse beta Fc gamma receptor II gene.";
J. Immunol. 146:369-376(1991).
[6]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB1').
STRAIN=DBA/2J; TISSUE=Mast cell;
PubMed=8683114;
Latour S., Fridman W.H., Daeron M.;
"Identification, molecular cloning, biologic properties, and tissue
distribution of a novel isoform of murine low-affinity IgG receptor
homologous to human Fc gamma RIIB1.";
J. Immunol. 157:189-197(1996).
[7]
NUCLEOTIDE SEQUENCE [MRNA] OF 30-330 (ISOFORMS IIB1 AND IIB2).
STRAIN=DBA/2J, and NZB; TISSUE=Spleen;
PubMed=8537115; DOI=10.1007/bf00186618;
Sawchuk D.J., Mahmoudi M., Cairns E., Sinclair N.R.S.;
"Nonsynonymous mutations in an Fc-receptor structural gene in NZB mice.";
Immunogenetics 43:112-113(1996).
[8]
NUCLEOTIDE SEQUENCE [MRNA] OF 17-45.
PubMed=2944118; DOI=10.1073/pnas.83.18.6980;
Hibbs M.L., Walker I.D., Kirszbaum L., Peitersz G.A., Deacon N.J.,
Chambers G.W., McKenzie I.F.C., Hogarth P.M.;
"The murine Fc receptor for immunoglobulin: purification, partial amino
acid sequence, and isolation of cDNA clones.";
Proc. Natl. Acad. Sci. U.S.A. 83:6980-6984(1986).
[9]
CHARACTERIZATION OF ISOFORM IIB3.
TISSUE=Macrophage;
PubMed=8398981; DOI=10.1093/intimm/5.8.859;
Tartour E., de la Salle H., de la Salle C., Teillaud C., Camoin L.,
Galinha A., Latour S., Hanau D., Fridman W.H., Sautes C.;
"Identification, in mouse macrophages and in serum, of a soluble receptor
for the Fc portion of IgG (Fc gamma R) encoded by an alternatively spliced
transcript of the Fc gamma RII gene.";
Int. Immunol. 5:859-868(1993).
[10]
PHOSPHORYLATION, AND INTERACTION WITH LYN.
PubMed=9469421;
Malbec O., Fong D.C., Turner M., Tybulewicz V.L., Cambier J.C.,
Fridman W.H., Daeron M.;
"Fc epsilon receptor I-associated lyn-dependent phosphorylation of Fc gamma
receptor IIB during negative regulation of mast cell activation.";
J. Immunol. 160:1647-1658(1998).
[11]
PHOSPHORYLATION AT TYR-290; TYR-309 AND TYR-326.
PubMed=11035084; DOI=10.4049/jimmunol.165.8.4453;
Fong D.C., Brauweiler A., Minskoff S.A., Bruhns P., Tamir I., Mellman I.,
Daeron M., Cambier J.C.;
"Mutational analysis reveals multiple distinct sites within Fc gamma
receptor IIB that function in inhibitory signaling.";
J. Immunol. 165:4453-4462(2000).
-!- FUNCTION: Receptor for the Fc region of complexed immunoglobulins
gamma. Low affinity receptor. Involved in a variety of effector and
regulatory functions such as phagocytosis of antigen-antibody complexes
from the circulation and modulation of antibody production by B-cells.
Isoform IIB1 and isoform IIB1' form caps but fail to mediate
endocytosis or phagocytosis. Isoform IIB2 can mediate the endocytosis
of soluble immune complexes via clathrin-coated pits. Isoform IIB1 and
isoform IIB2 can down-regulate B-cell, T-cell, and mast cell activation
when coaggregated to B-cell receptors for AG (BCR), T-cell receptors
for AG (TCR), and Fc receptors, respectively.
-!- SUBUNIT: Interacts with FGR (By similarity). Interacts with LYN.
{ECO:0000250, ECO:0000269|PubMed:9469421}.
-!- SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane
protein.
-!- SUBCELLULAR LOCATION: [Isoform IIB1]: Cytoplasm, cytoskeleton.
Note=Binds the cytoskeleton and is not localized in endocytotic pits.
-!- SUBCELLULAR LOCATION: [Isoform IIB3]: Secreted. Note=Released as a
soluble molecule.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=IIB1; Synonyms=Beta-1;
IsoId=P08101-1; Sequence=Displayed;
Name=IIB2; Synonyms=Beta-2;
IsoId=P08101-2; Sequence=VSP_002640;
Name=IIB1'; Synonyms=Beta-1';
IsoId=P08101-3; Sequence=VSP_002641;
Name=IIB3; Synonyms=Beta-3;
IsoId=P08101-4; Sequence=Not described;
-!- TISSUE SPECIFICITY: Widely expressed by cells of hemopoietic origin.
The isoforms are differentially expressed. Isoform IIB1 is
preferentially expressed by cells of the lymphoid lineage, isoform IIB2
by cells of the myeloid lineage, and isoform IIB3 is released by
macrophages and is present in the serum. Isoform IIB1' is expressed in
myeloid and lymphoid cell lines, in normal spleen cells, and in resting
or LPS-activated B-cells but is not detected in mesenteric lymph node
cells.
-!- DOMAIN: Contains 1 copy of a cytoplasmic motif that is referred to as
the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is
involved in modulation of cellular responses. The phosphorylated ITIM
motif can bind the SH2 domain of several SH2-containing phosphatases.
Another tyrosine-containing sequence, more C-terminal, accounts for the
ability of isoform IIB2 to trigger the phagocytosis of particulate
immuno complexes.
-!- PTM: Glycosylated.
-!- PTM: When coaggregated to BCR, isoform IIB1 and isoform IIB1' become
tyrosine phosphorylated and bind to the SH2 domains of the protein
tyrosine phosphatase PTPC1. Phosphorylated by SRC-type Tyr-kinases such
as LYN, BLK, FYN and SYK (By similarity). {ECO:0000250}.
-!- POLYMORPHISM: Ly-17 alloantigenic system involves residues 116 and 161.
Ly-17.1 mice are Pro-116 and Glu-161; Ly-17.2 mice are Leu-116 and Leu-
161. These polymorphisms do not affect IgG binding.
{ECO:0000269|PubMed:2138587}.
-!- SEQUENCE CAUTION:
Sequence=CAA28309.1; Type=Erroneous initiation; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; M16367; AAA37608.1; -; mRNA.
EMBL; M14216; AAA37609.1; -; mRNA.
EMBL; M17515; AAA37607.1; -; mRNA.
EMBL; M31312; AAA37610.1; -; Genomic_DNA.
EMBL; X04648; CAA28309.1; ALT_INIT; mRNA.
EMBL; U31801; AAA92707.1; -; mRNA.
EMBL; U31802; AAA92708.1; -; mRNA.
EMBL; U31803; AAA92709.1; -; mRNA.
EMBL; U31804; AAA92710.1; -; mRNA.
EMBL; M14276; AAA37605.1; -; mRNA.
EMBL; U51629; AAA97464.1; -; mRNA.
PIR; A40071; A40071.
PIR; B40071; FCMSG1.
PIR; I49660; I49660.
RefSeq; NP_034317.1; NM_010187.2.
SMR; P08101; -.
BioGRID; 199619; 3.
ELM; P08101; -.
IntAct; P08101; 1.
MINT; P08101; -.
STRING; 10090.ENSMUSP00000027966; -.
MEROPS; I43.001; -.
GlyConnect; 342; 18 N-Linked glycans.
GlyGen; P08101; 4 sites.
iPTMnet; P08101; -.
PhosphoSitePlus; P08101; -.
jPOST; P08101; -.
PaxDb; P08101; -.
PRIDE; P08101; -.
ProteomicsDB; 272973; -. [P08101-1]
ProteomicsDB; 272974; -. [P08101-2]
ProteomicsDB; 272975; -. [P08101-3]
GeneID; 14130; -.
KEGG; mmu:14130; -.
UCSC; uc007dms.2; mouse. [P08101-1]
UCSC; uc007dmt.2; mouse. [P08101-2]
CTD; 2213; -.
MGI; MGI:95499; Fcgr2b.
eggNOG; ENOG502SVEW; Eukaryota.
InParanoid; P08101; -.
PhylomeDB; P08101; -.
Reactome; R-MMU-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
Reactome; R-MMU-2029481; FCGR activation.
Reactome; R-MMU-2029482; Regulation of actin dynamics for phagocytic cup formation.
Reactome; R-MMU-2029485; Role of phospholipids in phagocytosis.
Reactome; R-MMU-6798695; Neutrophil degranulation.
BioGRID-ORCS; 14130; 0 hits in 52 CRISPR screens.
ChiTaRS; Fcgr2b; mouse.
PRO; PR:P08101; -.
Proteomes; UP000000589; Unplaced.
RNAct; P08101; protein.
GO; GO:0044297; C:cell body; IDA:ARUK-UCL.
GO; GO:0009986; C:cell surface; ISO:MGI.
GO; GO:0005856; C:cytoskeleton; IEA:UniProtKB-SubCell.
GO; GO:0043197; C:dendritic spine; IDA:ARUK-UCL.
GO; GO:0009897; C:external side of plasma membrane; IDA:MGI.
GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; IDA:MGI.
GO; GO:0005887; C:integral component of plasma membrane; ISO:MGI.
GO; GO:0045121; C:membrane raft; ISO:MGI.
GO; GO:0005886; C:plasma membrane; IDA:ARUK-UCL.
GO; GO:0055037; C:recycling endosome; ISO:MGI.
GO; GO:0001540; F:amyloid-beta binding; ISO:MGI.
GO; GO:0019864; F:IgG binding; IDA:MGI.
GO; GO:0019865; F:immunoglobulin binding; ISO:MGI.
GO; GO:0019772; F:low-affinity IgG receptor activity; ISO:MGI.
GO; GO:0044877; F:protein-containing complex binding; ISO:MGI.
GO; GO:0004888; F:transmembrane signaling receptor activity; IBA:GO_Central.
GO; GO:0019886; P:antigen processing and presentation of exogenous peptide antigen via MHC class II; IMP:MGI.
GO; GO:0007166; P:cell surface receptor signaling pathway; IMP:MGI.
GO; GO:1904646; P:cellular response to amyloid-beta; IMP:ARUK-UCL.
GO; GO:0071219; P:cellular response to molecule of bacterial origin; IMP:MGI.
GO; GO:0021549; P:cerebellum development; IMP:ARUK-UCL.
GO; GO:0006952; P:defense response; IMP:MGI.
GO; GO:0016358; P:dendrite development; IMP:ARUK-UCL.
GO; GO:0032456; P:endocytic recycling; ISO:MGI.
GO; GO:0038096; P:Fc-gamma receptor signaling pathway involved in phagocytosis; ISO:MGI.
GO; GO:0002434; P:immune complex clearance; ISO:MGI.
GO; GO:0016064; P:immunoglobulin mediated immune response; IMP:MGI.
GO; GO:0002865; P:negative regulation of acute inflammatory response to antigenic stimulus; IMP:MGI.
GO; GO:0030889; P:negative regulation of B cell proliferation; IMP:MGI.
GO; GO:0050859; P:negative regulation of B cell receptor signaling pathway; ISO:MGI.
GO; GO:0002924; P:negative regulation of humoral immune response mediated by circulating immunoglobulin; IMP:MGI.
GO; GO:0050777; P:negative regulation of immune response; IMP:MGI.
GO; GO:0002638; P:negative regulation of immunoglobulin production; IMP:MGI.
GO; GO:0002862; P:negative regulation of inflammatory response to antigenic stimulus; IMP:MGI.
GO; GO:0032693; P:negative regulation of interleukin-10 production; IMP:MGI.
GO; GO:0033030; P:negative regulation of neutrophil apoptotic process; ISO:MGI.
GO; GO:0050765; P:negative regulation of phagocytosis; IMP:MGI.
GO; GO:0001811; P:negative regulation of type I hypersensitivity; IMP:MGI.
GO; GO:0006911; P:phagocytosis, engulfment; IDA:MGI.
GO; GO:0051091; P:positive regulation of DNA-binding transcription factor activity; IMP:ARUK-UCL.
GO; GO:0046330; P:positive regulation of JNK cascade; IMP:ARUK-UCL.
GO; GO:1901216; P:positive regulation of neuron death; IMP:ARUK-UCL.
GO; GO:0050766; P:positive regulation of phagocytosis; IDA:MGI.
GO; GO:1905898; P:positive regulation of response to endoplasmic reticulum stress; IMP:ARUK-UCL.
GO; GO:0006898; P:receptor-mediated endocytosis; ISO:MGI.
GO; GO:1902950; P:regulation of dendritic spine maintenance; IMP:ARUK-UCL.
GO; GO:0050776; P:regulation of immune response; IBA:GO_Central.
GO; GO:0048169; P:regulation of long-term neuronal synaptic plasticity; IMP:ARUK-UCL.
GO; GO:0009617; P:response to bacterium; IMP:MGI.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
Pfam; PF13895; Ig_2; 2.
SMART; SM00409; IG; 2.
SUPFAM; SSF48726; SSF48726; 2.
PROSITE; PS50835; IG_LIKE; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Cytoplasm; Cytoskeleton;
Direct protein sequencing; Disulfide bond; Glycoprotein;
IgG-binding protein; Immunoglobulin domain; Membrane; Phosphoprotein;
Receptor; Reference proteome; Repeat; Secreted; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1..29
CHAIN 30..330
/note="Low affinity immunoglobulin gamma Fc region receptor
II"
/id="PRO_0000015143"
TOPO_DOM 30..210
/note="Extracellular"
/evidence="ECO:0000255"
TRANSMEM 211..231
/note="Helical"
/evidence="ECO:0000255"
TOPO_DOM 232..330
/note="Cytoplasmic"
/evidence="ECO:0000255"
DOMAIN 50..106
/note="Ig-like C2-type 1"
DOMAIN 131..189
/note="Ig-like C2-type 2"
MOTIF 307..312
/note="ITIM motif"
MOD_RES 290
/note="Phosphotyrosine"
/evidence="ECO:0000269|PubMed:11035084"
MOD_RES 309
/note="Phosphotyrosine; by SRC-type Tyr-kinases"
/evidence="ECO:0000250"
MOD_RES 326
/note="Phosphotyrosine"
/evidence="ECO:0000269|PubMed:11035084"
CARBOHYD 65
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 92
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 166
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 173
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
DISULFID 57..99
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
DISULFID 138..182
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
VAR_SEQ 243..290
/note="ALPGNPDHREMGETLPEEVGEYRQPSGGSVPVSPGPPSGLEPTSSSPY ->
D (in isoform IIB2)"
/evidence="ECO:0000303|PubMed:3024012,
ECO:0000303|PubMed:8537115"
/id="VSP_002640"
VAR_SEQ 262..290
/note="GEYRQPSGGSVPVSPGPPSGLEPTSSSPY -> D (in isoform
IIB1')"
/evidence="ECO:0000303|PubMed:8683114"
/id="VSP_002641"
VARIANT 116
/note="S -> L (in strain: DBA/2; Ly17.2 allotype)"
/evidence="ECO:0000269|PubMed:2138587"
VARIANT 116
/note="S -> P (in strain: NZB; Ly17.1 allotype)"
/evidence="ECO:0000269|PubMed:2138587"
VARIANT 145
/note="L -> P"
VARIANT 161
/note="H -> L (in strain: DBA/2; Ly17.2 allotype)"
/evidence="ECO:0000269|PubMed:2138587"
VARIANT 161
/note="H -> Q (in strain: NZB; Ly17.1 allotype)"
/evidence="ECO:0000269|PubMed:2138587"
VARIANT 190
/note="L -> Q"
VARIANT 195
/note="P -> T (in strain: NZB)"
VARIANT 287
/note="S -> I (in strain: NZB)"
CONFLICT 270..278
/note="GSVPVSPGP -> LSACQPRA (in Ref. 1; AAA37608)"
/evidence="ECO:0000305"
CONFLICT 299
/note="A -> P (in Ref. 3 and 4)"
/evidence="ECO:0000305"
SEQUENCE 330 AA; 36695 MW; A463B9EFF2717511 CRC64;
MESNWTVHVF SRTLCHMLLW TAVLNLAAGT HDLPKAVVKL EPPWIQVLKE DTVTLTCEGT
HNPGNSSTQW FHNGRSIRSQ VQASYTFKAT VNDSGEYRCQ MEQTRLSDPV DLGVISDWLL
LQTPQLVFLE GETITLRCHS WRNKLLNRIS FFHNEKSVRY HHYSSNFSIP KANHSHSGDY
YCKGSLGRTL HQSKPVTITV QGPKSSRSLP VLTIVAAVTG IAVAAIVIIL VSLVYLKKKQ
VPALPGNPDH REMGETLPEE VGEYRQPSGG SVPVSPGPPS GLEPTSSSPY NPPDLEEAAK
TEAENTITYS LLKHPEALDE ETEHDYQNHI


Related products :

Catalog number Product name Quantity
U1579m CLIA Fc gamma receptor IIB,Fc-gamma RII,Fc-gamma-RIIB,Fcgr2,Fcgr2b,FcRII,IgG Fc receptor II beta,Low affinity immunoglobulin gamma Fc region receptor II,Ly-17,Ly-17,Lymphocyte antigen 17,Mouse,Mus mus 96T
E1579m ELISA Fc gamma receptor IIB,Fc-gamma RII,Fc-gamma-RIIB,Fcgr2,Fcgr2b,FcRII,IgG Fc receptor II beta,Low affinity immunoglobulin gamma Fc region receptor II,Ly-17,Ly-17,Lymphocyte antigen 17,Mouse,Mus mu 96T
E1579m ELISA kit Fc gamma receptor IIB,Fc-gamma RII,Fc-gamma-RIIB,Fcgr2,Fcgr2b,FcRII,IgG Fc receptor II beta,Low affinity immunoglobulin gamma Fc region receptor II,Ly-17,Ly-17,Lymphocyte antigen 17,Mouse,M 96T
EIAAB14658 CD32,CDw32,FCG2,Fc-gamma RII-b,Fc-gamma-RIIb,FCGR2B,FcRII-b,Homo sapiens,Human,IGFR2,IgG Fc receptor II-b,Low affinity immunoglobulin gamma Fc region receptor II-b
EIAAB14659 CD32,CDw32,FCG2,Fc-gamma RII-c,Fc-gamma-RIIc,FCGR2C,FcRII-c,Homo sapiens,Human,IGFR2,IgG Fc receptor II-c,Low affinity immunoglobulin gamma Fc region receptor II-c
E1579h ELISA kit CD32,CDw32,FCG2,Fc-gamma RII-a,Fc-gamma-RIIa,FCGR2A,FCGR2A1,FcRII-a,Homo sapiens,Human,IGFR2,IgG Fc receptor II-a,Low affinity immunoglobulin gamma Fc region receptor II-a 96T
U1579h CLIA CD32,CDw32,FCG2,Fc-gamma RII-a,Fc-gamma-RIIa,FCGR2A,FCGR2A1,FcRII-a,Homo sapiens,Human,IGFR2,IgG Fc receptor II-a,Low affinity immunoglobulin gamma Fc region receptor II-a 96T
E1579h ELISA CD32,CDw32,FCG2,Fc-gamma RII-a,Fc-gamma-RIIa,FCGR2A,FCGR2A1,FcRII-a,Homo sapiens,Human,IGFR2,IgG Fc receptor II-a,Low affinity immunoglobulin gamma Fc region receptor II-a 96T
E1579r ELISA Fc-gamma RII,Fcgr2,Fcgr2b,FcRII,IgG Fc receptor II beta,Low affinity immunoglobulin gamma Fc region receptor II,Rat,Rattus norvegicus 96T
E1579r ELISA kit Fc-gamma RII,Fcgr2,Fcgr2b,FcRII,IgG Fc receptor II beta,Low affinity immunoglobulin gamma Fc region receptor II,Rat,Rattus norvegicus 96T
U1579r CLIA Fc-gamma RII,Fcgr2,Fcgr2b,FcRII,IgG Fc receptor II beta,Low affinity immunoglobulin gamma Fc region receptor II,Rat,Rattus norvegicus 96T
E1579b ELISA kit Bos taurus,Bovine,Fc-gamma RII,FCGR2,FcRII,IgG Fc receptor II,Low affinity immunoglobulin gamma Fc region receptor II 96T
E1579b ELISA Bos taurus,Bovine,Fc-gamma RII,FCGR2,FcRII,IgG Fc receptor II,Low affinity immunoglobulin gamma Fc region receptor II 96T
U1579b CLIA Bos taurus,Bovine,Fc-gamma RII,FCGR2,FcRII,IgG Fc receptor II,Low affinity immunoglobulin gamma Fc region receptor II 96T
EIAAB14660 CD16B,FCG3,Fc-gamma RIII,Fc-gamma RIIIb,Fc-gamma RIII-beta,FCGR3,FCGR3B,FcR-10,FcRIII,FcRIIIb,Homo sapiens,Human,IGFR3,IgG Fc receptor III-1,Low affinity immunoglobulin gamma Fc region receptor III-B
U1580h CLIA CD16A,CD16a antigen,FCG3,Fc-gamma RIII,Fc-gamma RIIIa,Fc-gamma RIII-alpha,FCGR3,FCGR3A,FcR-10,FcRIII,FcRIIIa,Homo sapiens,Human,IGFR3,IgG Fc receptor III-2,Low affinity immunoglobulin gamma Fc re 96T
E1580h ELISA CD16A,CD16a antigen,FCG3,Fc-gamma RIII,Fc-gamma RIIIa,Fc-gamma RIII-alpha,FCGR3,FCGR3A,FcR-10,FcRIII,FcRIIIa,Homo sapiens,Human,IGFR3,IgG Fc receptor III-2,Low affinity immunoglobulin gamma Fc r 96T
E1580h ELISA kit CD16A,CD16a antigen,FCG3,Fc-gamma RIII,Fc-gamma RIIIa,Fc-gamma RIII-alpha,FCGR3,FCGR3A,FcR-10,FcRIII,FcRIIIa,Homo sapiens,Human,IGFR3,IgG Fc receptor III-2,Low affinity immunoglobulin gamma 96T
E1578h ELISA kit FCG1,Fc-gamma RI,Fc-gamma RIA,FcgammaRIa,FCGR1,FCGR1A,FcRI,High affinity immunoglobulin gamma Fc receptor I,Homo sapiens,Human,IGFR1,IgG Fc receptor I 96T
U1578h CLIA FCG1,Fc-gamma RI,Fc-gamma RIA,FcgammaRIa,FCGR1,FCGR1A,FcRI,High affinity immunoglobulin gamma Fc receptor I,Homo sapiens,Human,IGFR1,IgG Fc receptor I 96T
E1578h ELISA FCG1,Fc-gamma RI,Fc-gamma RIA,FcgammaRIa,FCGR1,FCGR1A,FcRI,High affinity immunoglobulin gamma Fc receptor I,Homo sapiens,Human,IGFR1,IgG Fc receptor I 96T
E1580m ELISA Fc-gamma RIII,Fcgr3,FcRIII,IgG Fc receptor III,Low affinity immunoglobulin gamma Fc region receptor III,Mouse,Mus musculus 96T
U1580m CLIA Fc-gamma RIII,Fcgr3,FcRIII,IgG Fc receptor III,Low affinity immunoglobulin gamma Fc region receptor III,Mouse,Mus musculus 96T
E1580r ELISA Fc-gamma RIII,Fcgr3,FcRIII,IgG Fc receptor III,Low affinity immunoglobulin gamma Fc region receptor III,Rat,Rattus norvegicus 96T
U1580r CLIA Fc-gamma RIII,Fcgr3,FcRIII,IgG Fc receptor III,Low affinity immunoglobulin gamma Fc region receptor III,Rat,Rattus norvegicus 96T
Pathways :
WP2292: Chemokine signaling pathway
WP537: Translation Factors
WP1225: estrogen signalling
WP32: Translation Factors
WP2328: Allograft rejection
WP262: EBV LMP1 signaling
WP542: Electron Transport Chain
WP1224: EBV LMP1 signaling
WP1722: Th1/Th2
WP809: TGF-beta Receptor Signaling Pathway
WP1161: TGF-beta Receptor Signaling Pathway
WP362: TGF-beta Receptor Signaling Pathway
WP868: estrogen signalling
WP760: estrogen signalling
WP566: canonical wnt - zebrafish
WP1993: angiogenesis overview
WP866: EBV LMP1 signaling
WP152: FGF signaling pathway
WP2152: BDNF
WP758: EBV LMP1 signaling
WP258: TGF-beta Receptor Signaling Pathway
WP1367: TGF-beta Receptor Signaling Pathway
WP2199: Seed Development
WP926: TGF-beta Receptor Signaling Pathway
WP2006: Squamous cell TarBase

Related Genes :
[Fcgr2 Fcgr2b Ly-17] Low affinity immunoglobulin gamma Fc region receptor II (Fc gamma receptor IIB) (Fc-gamma RII) (Fc-gamma-RIIB) (FcRII) (IgG Fc receptor II beta) (Lymphocyte antigen 17) (Ly-17) (CD antigen CD32)
[FCGR2B CD32 FCG2 IGFR2] Low affinity immunoglobulin gamma Fc region receptor II-b (IgG Fc receptor II-b) (CDw32) (Fc-gamma RII-b) (Fc-gamma-RIIb) (FcRII-b) (CD antigen CD32)
[FCGR3A CD16A FCG3 FCGR3 IGFR3] Low affinity immunoglobulin gamma Fc region receptor III-A (CD16a antigen) (Fc-gamma RIII-alpha) (Fc-gamma RIII) (Fc-gamma RIIIa) (FcRIII) (FcRIIIa) (FcR-10) (IgG Fc receptor III-2) (CD antigen CD16a)
[FCGR3B CD16B FCG3 FCGR3 IGFR3] Low affinity immunoglobulin gamma Fc region receptor III-B (Fc-gamma RIII-beta) (Fc-gamma RIII) (Fc-gamma RIIIb) (FcRIII) (FcRIIIb) (FcR-10) (IgG Fc receptor III-1) (CD antigen CD16b)
[Fcgr4] Low affinity immunoglobulin gamma Fc region receptor IV (CD16-2) (FcgammaRIV)
[Fcgr1 Fcg1] High affinity immunoglobulin gamma Fc receptor I (IgG Fc receptor I) (Fc-gamma RI) (FcRI) (CD antigen CD64)
[FCGR3] Low affinity immunoglobulin gamma Fc region receptor III (IgG Fc receptor III) (Cytolytic trigger molecule G7) (Fc-gamma RIII) (FcRIII) (CD antigen CD16)
[FCGR3] Low affinity immunoglobulin gamma Fc region receptor III (IgG Fc receptor III) (Fc-gamma RIII) (FcRIII) (CD antigen CD16)
[Fcgrt Fcrn] IgG receptor FcRn large subunit p51 (FcRn) (IgG Fc fragment receptor transporter alpha chain) (Neonatal Fc receptor)
[FCGR3 FCGRIII] Low affinity immunoglobulin gamma Fc region receptor III (IgG Fc receptor III) (Fc-gamma RIII) (FcRIII) (CD antigen CD16)
[FCGRT FCRN] IgG receptor FcRn large subunit p51 (FcRn) (IgG Fc fragment receptor transporter alpha chain) (Neonatal Fc receptor)
[Ptprc Ly-5] Receptor-type tyrosine-protein phosphatase C (EC 3.1.3.48) (Leukocyte common antigen) (L-CA) (Lymphocyte antigen 5) (Ly-5) (T200) (CD antigen CD45)
[Fcgr4] Low affinity immunoglobulin gamma Fc region receptor IV (FcgammaRIV)
[IGHG1] Immunoglobulin heavy constant gamma 1 (Ig gamma-1 chain C region) (Ig gamma-1 chain C region EU) (Ig gamma-1 chain C region KOL) (Ig gamma-1 chain C region NIE)
[Fcamr] High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor (Fc alpha/mu receptor) (mFcamR) (CD antigen CD351)
[CD3G T3G] T-cell surface glycoprotein CD3 gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g)
[IGHG2] Immunoglobulin heavy constant gamma 2 (Ig gamma-2 chain C region) (Ig gamma-2 chain C region DOT) (Ig gamma-2 chain C region TIL) (Ig gamma-2 chain C region ZIE)
[LILRB1 ILT2 LIR1 MIR7] Leukocyte immunoglobulin-like receptor subfamily B member 1 (LIR-1) (Leukocyte immunoglobulin-like receptor 1) (CD85 antigen-like family member J) (Immunoglobulin-like transcript 2) (ILT-2) (Monocyte/macrophage immunoglobulin-like receptor 7) (MIR-7) (CD antigen CD85j)
[Cd44 Ly-24] CD44 antigen (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Hermes antigen) (Hyaluronate receptor) (Lymphocyte antigen 24) (Ly-24) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)
[FCGR3] Low affinity immunoglobulin gamma Fc region receptor III (IgG Fc receptor III) (Fc-gamma RIII) (FcRIII) (CD antigen CD16)
[FCRLA FCRL FCRL1 FCRLM1 FCRX FREB UNQ291/PRO329] Fc receptor-like A (Fc receptor homolog expressed in B-cells) (Fc receptor-like and mucin-like protein 1) (Fc receptor-like protein) (Fc receptor-related protein X) (FcRX)
[Havcr2 Tim3 Timd3] Hepatitis A virus cellular receptor 2 homolog (HAVcr-2) (T-cell immunoglobulin and mucin domain-containing protein 3) (TIMD-3) (T-cell immunoglobulin mucin receptor 3) (TIM-3) (T-cell membrane protein 3) (CD antigen CD366)
[FCRL3 FCRH3 IFGP3 IRTA3 SPAP2] Fc receptor-like protein 3 (FcR-like protein 3) (FcRL3) (Fc receptor homolog 3) (FcRH3) (IFGP family protein 3) (hIFGP3) (Immune receptor translocation-associated protein 3) (SH2 domain-containing phosphatase anchor protein 2) (CD antigen CD307c)
[PTPRC CD45] Receptor-type tyrosine-protein phosphatase C (EC 3.1.3.48) (Leukocyte common antigen) (L-CA) (T200) (CD antigen CD45)
[IGHG3] Immunoglobulin heavy constant gamma 3 (HDC) (Heavy chain disease protein) (Ig gamma-3 chain C region)
[Inpp5d 7a33 Ship Ship1] Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 (EC 3.1.3.86) (Inositol polyphosphate-5-phosphatase D) (EC 3.1.3.56) (Inositol polyphosphate-5-phosphatase of 145 kDa) (SIP-145) (Phosphatidylinositol-4,5-bisphosphate 5-phosphatase) (EC 3.1.3.36) (SH2 domain-containing inositol 5'-phosphatase 1) (SH2 domain-containing inositol phosphatase 1) (SHIP-1) (p150Ship)
[Fcgrt Fcrn] IgG receptor FcRn large subunit p51 (FcRn) (IgG Fc fragment receptor transporter alpha chain) (Neonatal Fc receptor)
[FCRL6 FCRH6] Fc receptor-like protein 6 (FcR-like protein 6) (FcRL6) (Fc receptor homolog 6) (FcRH6) (IFGP6)
[HAVCR2 TIM3 TIMD3] Hepatitis A virus cellular receptor 2 (HAVcr-2) (T-cell immunoglobulin and mucin domain-containing protein 3) (TIMD-3) (T-cell immunoglobulin mucin receptor 3) (TIM-3) (T-cell membrane protein 3) (CD antigen CD366)
[LILRA4 ILT7] Leukocyte immunoglobulin-like receptor subfamily A member 4 (CD85 antigen-like family member G) (Immunoglobulin-like transcript 7) (ILT-7) (CD antigen CD85g)

Bibliography :