GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Low molecular weight phosphotyrosine protein phosphatase (LMW-PTP) (LMW-PTPase) (EC 3.1.3.48) (Low molecular weight cytosolic acid phosphatase) (EC 3.1.3.2)

 PPAC_RAT                Reviewed;         158 AA.
P41498; Q9R138;
01-NOV-1995, integrated into UniProtKB/Swiss-Prot.
23-JAN-2007, sequence version 3.
16-JAN-2019, entry version 146.
RecName: Full=Low molecular weight phosphotyrosine protein phosphatase;
Short=LMW-PTP;
Short=LMW-PTPase;
EC=3.1.3.48;
AltName: Full=Low molecular weight cytosolic acid phosphatase;
EC=3.1.3.2;
Name=Acp1;
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND INTERACTION WITH SPTAN1.
STRAIN=Sprague-Dawley; TISSUE=Kidney;
PubMed=11971983; DOI=10.1128/MCB.22.10.3527-3536.2002;
Nicolas G., Fournier C.M., Galand C., Malbert-Colas L., Bournier O.,
Kroviarski Y., Bourgeois M., Camonis J.H., Dhermy D., Grandchamp B.,
Lecomte M.-C.;
"Tyrosine phosphorylation regulates alpha II spectrin cleavage by
calpain.";
Mol. Cell. Biol. 22:3527-3536(2002).
[2]
PROTEIN SEQUENCE (ISOFORMS 1 AND 2), CLEAVAGE OF INITIATOR METHIONINE,
AND ACETYLATION AT ALA-2.
TISSUE=Liver;
PubMed=1388675; DOI=10.1007/BF01024871;
Manao G., Pazzagli L., Cirri P., Caselli A., Camici G., Cappugi G.,
Saeed A., Ramponi G.;
"Rat liver low M(r) phosphotyrosine protein phosphatase isoenzymes:
purification and amino acid sequences.";
J. Protein Chem. 11:333-345(1992).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Pituitary;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
PROTEIN SEQUENCE OF 20-28; 42-59 AND 114-124, AND IDENTIFICATION BY
MASS SPECTROMETRY.
STRAIN=Sprague-Dawley; TISSUE=Hippocampus, and Spinal cord;
Lubec G., Afjehi-Sadat L., Diao W.;
Submitted (APR-2007) to UniProtKB.
-!- FUNCTION: Acts on tyrosine phosphorylated proteins, low-MW aryl
phosphates and natural and synthetic acyl phosphates.
-!- CATALYTIC ACTIVITY:
Reaction=H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein]
+ phosphate; Xref=Rhea:RHEA:10684, Rhea:RHEA-COMP:10136,
Rhea:RHEA-COMP:10137, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474,
ChEBI:CHEBI:46858, ChEBI:CHEBI:82620; EC=3.1.3.48;
-!- CATALYTIC ACTIVITY:
Reaction=a phosphate monoester + H2O = an alcohol + phosphate;
Xref=Rhea:RHEA:15017, ChEBI:CHEBI:15377, ChEBI:CHEBI:30879,
ChEBI:CHEBI:43474, ChEBI:CHEBI:67140; EC=3.1.3.2;
-!- SUBUNIT: Interacts with EPHA2; dephosphorylates EPHA2. Interacts
with EPHB1 (By similarity). Isoform 1 interacts with the SH3
domain of SPTAN1. {ECO:0000250, ECO:0000269|PubMed:11971983}.
-!- SUBCELLULAR LOCATION: Cytoplasm.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Comment=Additional isoforms seem to exist.;
Name=1; Synonyms=ACP1, A;
IsoId=P41498-1; Sequence=Displayed;
Name=2; Synonyms=ACP2, B;
IsoId=P41498-2; Sequence=VSP_004705;
-!- SIMILARITY: Belongs to the low molecular weight phosphotyrosine
protein phosphatase family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF171072; AAD50990.1; -; mRNA.
EMBL; BC062229; AAH62229.1; -; mRNA.
PIR; A53874; A53874.
RefSeq; NP_067085.1; NM_021262.2. [P41498-1]
UniGene; Rn.108187; -.
UniGene; Rn.154499; -.
UniGene; Rn.202830; -.
UniGene; Rn.220315; -.
ProteinModelPortal; P41498; -.
SMR; P41498; -.
BioGrid; 246352; 1.
STRING; 10116.ENSRNOP00000007287; -.
iPTMnet; P41498; -.
PhosphoSitePlus; P41498; -.
SwissPalm; P41498; -.
jPOST; P41498; -.
PaxDb; P41498; -.
PRIDE; P41498; -.
GeneID; 24161; -.
KEGG; rno:24161; -.
UCSC; RGD:2020; rat. [P41498-1]
CTD; 52; -.
RGD; 2020; Acp1.
eggNOG; KOG3217; Eukaryota.
eggNOG; COG0394; LUCA.
HOGENOM; HOG000273094; -.
HOVERGEN; HBG007540; -.
InParanoid; P41498; -.
KO; K14394; -.
OrthoDB; 1362234at2759; -.
PhylomeDB; P41498; -.
TreeFam; TF353727; -.
PRO; PR:P41498; -.
Proteomes; UP000002494; Unplaced.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell.
GO; GO:0043005; C:neuron projection; IDA:RGD.
GO; GO:0003993; F:acid phosphatase activity; IDA:RGD.
GO; GO:0004726; F:non-membrane spanning protein tyrosine phosphatase activity; IEA:InterPro.
GO; GO:0004725; F:protein tyrosine phosphatase activity; IDA:RGD.
GO; GO:0017124; F:SH3 domain binding; IDA:RGD.
GO; GO:0007268; P:chemical synaptic transmission; IEP:RGD.
InterPro; IPR023485; Ptyr_pPase.
InterPro; IPR036196; Ptyr_pPase_sf.
InterPro; IPR002115; Tyr_Pase_low_mol_wt_mml.
InterPro; IPR017867; Tyr_phospatase_low_mol_wt.
Pfam; PF01451; LMWPc; 1.
PRINTS; PR00719; LMWPTPASE.
PRINTS; PR00720; MAMMALPTPASE.
SMART; SM00226; LMWPc; 1.
SUPFAM; SSF52788; SSF52788; 1.
1: Evidence at protein level;
Acetylation; Alternative splicing; Complete proteome; Cytoplasm;
Direct protein sequencing; Hydrolase; Phosphoprotein;
Protein phosphatase; Reference proteome.
INIT_MET 1 1 Removed. {ECO:0000269|PubMed:1388675}.
CHAIN 2 158 Low molecular weight phosphotyrosine
protein phosphatase.
/FTId=PRO_0000046561.
ACT_SITE 13 13 Nucleophile. {ECO:0000250}.
ACT_SITE 19 19 {ECO:0000250}.
ACT_SITE 130 130 Proton donor. {ECO:0000250}.
MOD_RES 2 2 N-acetylalanine.
{ECO:0000269|PubMed:1388675}.
MOD_RES 132 132 Phosphotyrosine.
{ECO:0000250|UniProtKB:P24666}.
MOD_RES 133 133 Phosphotyrosine.
{ECO:0000250|UniProtKB:P24666}.
VAR_SEQ 41 74 RIDSAATSTYEVGNPPDYRGQNCMKKHGIHMQHI -> AID
SSAVSDWNVGRPPDPRAVNCLRNHGISTAHK (in
isoform 2). {ECO:0000303|PubMed:1388675}.
/FTId=VSP_004705.
CONFLICT 2 2 A -> ACA (in Ref. 2; AA sequence).
{ECO:0000305}.
SEQUENCE 158 AA; 18152 MW; 5C454D4DA82FB094 CRC64;
MAEVGSKSVL FVCLGNICRS PIAEAVFRKL VTDENVSDNW RIDSAATSTY EVGNPPDYRG
QNCMKKHGIH MQHIARQITR EDFATFDYIL CMDESNLRDL NRKSNQVKNC KAKIELLGSY
DPQKQLIIED PYYGNDSDFE VVYQQCLRCC KAFLEKTH


Related products :

Catalog number Product name Quantity
EIAAB31954 ACP1,Adipocyte acid phosphatase,Homo sapiens,Human,LMW-PTP,LMW-PTPase,Low molecular weight cytosolic acid phosphatase,Low molecular weight phosphotyrosine protein phosphatase,Red cell acid phosphatase
EIAAB31958 ACP1,Bos taurus,Bovine,LMW-PTP,LMW-PTPase,Low molecular weight cytosolic acid phosphatase,Low molecular weight phosphotyrosine protein phosphatase
EIAAB31959 Acp1,LMW-PTP,LMW-PTPase,Low molecular weight cytosolic acid phosphatase,Low molecular weight phosphotyrosine protein phosphatase,Rat,Rattus norvegicus
EIAAB31957 Acp1,LMW-PTP,LMW-PTPase,Low molecular weight cytosolic acid phosphatase,Low molecular weight phosphotyrosine protein phosphatase,Mouse,Mus musculus
EIAAB31955 ACP1,LMW-PTP,LMW-PTPase,Low molecular weight cytosolic acid phosphatase,Low molecular weight phosphotyrosine protein phosphatase,Pig,Sus scrofa
EIAAB31956 ACP1,Chicken,Gallus gallus,LMW-PTP,LMW-PTPase,Low molecular weight cytosolic acid phosphatase,Low molecular weight phosphotyrosine protein phosphatase,RCJMB04_11a4
C201 Low Molecular Weight Phosphotyrosine Protein Phosphatase LMW-PTP 500
C201 Low Molecular Weight Phosphotyrosine Protein Phosphatase LMW-PTP lmg
CA88 E. coli Low Molecular Weight Phosphotyrosine Protein Phosphatase LMW-PTP 50
OR6A2_HUMAN Rat ELISA Kit FOR Low molecular weight phosphotyrosine protein phosphatase 96T
E0549h Rat ELISA Kit FOR Low molecular weight phosphotyrosine protein phosphatase 96T
C389 E. coli Low Molecular Weight Phosphotyrosine Protein Phosphatase LMW-PTP l0
SNRK_HUMAN Chicken ELISA Kit FOR Low molecular weight phosphotyrosine protein phosphatase 96T
E0705c Chicken ELISA Kit FOR Low molecular weight phosphotyrosine protein phosphatase 96T
CSB-EL001176RA Rat Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit 96T
CSB-EL001176PI Pig Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit SpeciesPig 96T
CSB-EL001176MO Mouse Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit 96T
CSB-EL001176HU Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit 96T
CSB-EL001176CH Chicken Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit 96T
CSB-EL001176RA Rat Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit SpeciesRat 96T
CSB-EL001176BO Bovine Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit 96T
CSB-EL001176CH Chicken Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit SpeciesChicken 96T
CSB-EL001176HU Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit SpeciesHuman 96T
CSB-EL001176MO Mouse Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit SpeciesMouse 96T
CSB-EL001176BO Bovine Low molecular weight phosphotyrosine protein phosphatase(ACP1) ELISA kit SpeciesBovine 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1654: gamma-Hexachlorocyclohexane degradation
WP1696: Riboflavin metabolism
WP1652: Fructose and mannose metabolism
WP1700: Selenoamino acid metabolism
WP1709: Thiamine metabolism
WP2199: Seed Development
WP2340: Thiamine (vitamin B1) biosynthesis and salvage
WP2341: vitamin B1 (thiamin) biosynthesis and salvage pathway
WP2349: vitamin B3 (niacin), NAD and NADP biosynthesis pathway
WP2353: vitamin B9 (folate) biosynthesis pathway
WP76: TCA Cycle
WP1008: amino acid conjugation of benzoic acid
WP1020: Fatty Acid Biosynthesis
WP1049: G Protein Signaling Pathways
WP105: Fatty Acid Beta Oxidation 2
WP1061: Fatty Acid Beta Oxidation
WP1075: Folic Acid Network
WP1107: Mitochondrial LC-Fatty Acid Beta-Oxidation
WP1127: amino acid conjugation of benzoic acid
WP1139: Fatty Acid Biosynthesis
WP1165: G Protein Signaling Pathways
WP1177: Fatty Acid Beta Oxidation
WP1192: Folic Acid Network
WP1207: Fatty Acid Beta Oxidation
WP121: Colanic Acid Building Blocks Biosynthesis

Related Genes :
[ACP1] Low molecular weight phosphotyrosine protein phosphatase (LMW-PTP) (LMW-PTPase) (EC 3.1.3.48) (Adipocyte acid phosphatase) (Low molecular weight cytosolic acid phosphatase) (EC 3.1.3.2) (Red cell acid phosphatase 1)
[KNG1 BDK KNG] Kininogen-1 (Alpha-2-thiol proteinase inhibitor) (Fitzgerald factor) (High molecular weight kininogen) (HMWK) (Williams-Fitzgerald-Flaujeac factor) [Cleaved into: Kininogen-1 heavy chain; T-kinin (Ile-Ser-Bradykinin); Bradykinin (Kallidin I); Lysyl-bradykinin (Kallidin II); Kininogen-1 light chain; Low molecular weight growth-promoting factor]
[arsC slr0946] Glutaredoxin arsenate reductase (EC 1.20.4.1) (Low molecular weight protein-tyrosine-phosphatase) (EC 3.1.3.48) (Protein ArsC) (SynArsC) (rSynArsC)
[ptpA Rv2234 MTCY427.15] Probable low molecular weight protein-tyrosine-phosphatase (PTPase) (EC 3.1.3.48)
[PTPN11 PTP2C SHPTP2] Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1D) (PTP-1D) (Protein-tyrosine phosphatase 2C) (PTP-2C) (SH-PTP2) (SHP-2) (Shp2) (SH-PTP3)
[Ptpn6 Hcp Hcph Ptp1C] Tyrosine-protein phosphatase non-receptor type 6 (EC 3.1.3.48) (70Z-SHP) (Hematopoietic cell protein-tyrosine phosphatase) (PTPTY-42) (Protein-tyrosine phosphatase 1C) (PTP-1C) (SH-PTP1) (SHP-1)
[Ptpro GLEPP1 Ptpn15 PTPU2] Receptor-type tyrosine-protein phosphatase O (R-PTP-O) (EC 3.1.3.48) (Glomerular epithelial protein 1) (Protein tyrosine phosphatase U2) (PTP-U2) (PTPase U2)
[PTPN13 PNP1 PTP1E PTPL1] Tyrosine-protein phosphatase non-receptor type 13 (EC 3.1.3.48) (Fas-associated protein-tyrosine phosphatase 1) (FAP-1) (PTP-BAS) (Protein-tyrosine phosphatase 1E) (PTP-E1) (hPTPE1) (Protein-tyrosine phosphatase PTPL1)
[Ptprn2] Receptor-type tyrosine-protein phosphatase N2 (R-PTP-N2) (EC 3.1.3.-) (EC 3.1.3.48) (PTP IA-2beta) (Phogrin) (Protein tyrosine phosphatase-NP) (PTP-NP) [Cleaved into: IA-2beta71; IA-2beta64; IA-2beta60]
[Ptprh SAP-1] Receptor-type tyrosine-protein phosphatase H (R-PTP-H) (EC 3.1.3.48) (Stomach cancer-associated protein tyrosine phosphatase 1) (SAP-1)
[PTPRQ] Phosphatidylinositol phosphatase PTPRQ (EC 3.1.3.-) (Receptor-type tyrosine-protein phosphatase Q) (PTP-RQ) (R-PTP-Q) (EC 3.1.3.48)
[EPM2A] Laforin (EC 3.1.3.-) (EC 3.1.3.16) (EC 3.1.3.48) (Glucan phosphatase) (Glycogen phosphatase) (Lafora PTPase) (LAFPTPase)
[hchA A8C65_13880 A9R57_25255 AKG99_20940 AMK83_16550 B7C53_22525 B9M99_11580 B9T59_01945 BJJ90_15205 BMT49_12710 BMT53_00170 BUE81_10670 BW690_17225 BZL69_29425 C2U48_24800 C5715_19445 C5N07_21380 C6669_19295 C7B06_02290 C7B07_03930 CDL37_00765 CG691_19145 CG705_13560 CG706_14580 CIJ94_05515 COD46_23180 CRD98_26150 D3I61_11545 DL800_09215 DNQ41_14245 DQE83_22775 DTL43_21780 DTL84_23375 DTM25_06080 EC95NR1_00961 ERS085379_01273 ERS085386_05041 HMPREF3040_01583 HW43_13705 NCTC10082_04431 NCTC10418_03071 NCTC10767_03558 NCTC11022_01867 NCTC11126_04427 NCTC11181_05650 NCTC12950_02263 NCTC13462_05714 NCTC8985_00529 NCTC9111_05933 NCTC9703_00277 PU06_24500 SAMEA3472055_03589 SAMEA3472056_01268 SAMEA3472070_00654 SAMEA3472080_04213 SAMEA3472090_03376 SAMEA3472110_00060 SAMEA3472112_00448 SAMEA3752372_00752 SAMEA3753106_00003 SAMEA3753391_00513 UN91_23615 WQ89_10695] Protein/nucleic acid deglycase HchA (EC 3.1.2.-) (EC 3.5.1.-) (EC 3.5.1.124) (Maillard deglycase)
[Ptpn1] Tyrosine-protein phosphatase non-receptor type 1 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1B) (PTP-1B) (Protein-tyrosine phosphatase HA2) (PTP-HA2)
[] Genome polyprotein [Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)]
[Ptprn2] Receptor-type tyrosine-protein phosphatase N2 (R-PTP-N2) (EC 3.1.3.-) (EC 3.1.3.48) (PTP NE-6) (PTPNE6) (Phogrin) [Cleaved into: IA-2beta60]
[Ptpn13 Ptp14] Tyrosine-protein phosphatase non-receptor type 13 (EC 3.1.3.48) (PTP36) (Protein tyrosine phosphatase DPZPTP) (Protein tyrosine phosphatase PTP-BL) (Protein-tyrosine phosphatase RIP)
[PTPRZ1 HTPZP2 PTPRZ PTPRZ2 PTPZ] Receptor-type tyrosine-protein phosphatase zeta (R-PTP-zeta) (EC 3.1.3.48) (Protein-tyrosine phosphatase receptor type Z polypeptide 1) (Protein-tyrosine phosphatase receptor type Z polypeptide 2) (R-PTP-zeta-2)
[PTPRN2 KIAA0387] Receptor-type tyrosine-protein phosphatase N2 (R-PTP-N2) (EC 3.1.3.-) (EC 3.1.3.48) (Islet cell autoantigen-related protein) (IAR) (ICAAR) (Phogrin) [Cleaved into: IA-2beta60]
[] Genome polyprotein [Cleaved into: Capsid protein C (Capsid protein) (Core protein); Protein prM (Precursor membrane protein); Peptide pr (Peptide precursor); Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)]
[PTPRH SAP1] Receptor-type tyrosine-protein phosphatase H (R-PTP-H) (EC 3.1.3.48) (Stomach cancer-associated protein tyrosine phosphatase 1) (SAP-1) (Transmembrane-type protein-tyrosine phosphatase type H)
[] Genome polyprotein [Cleaved into: P3; Protein 3AB; P1; Capsid protein VP0 (VP4-VP2); Capsid protein VP4 (P1A) (Virion protein 4); Capsid protein VP2 (P1B) (Virion protein 2); Capsid protein VP3 (P1C) (Virion protein 3); Capsid protein VP1 (P1D) (Virion protein 1); P2; Protease 2A (P2A) (EC 3.4.22.29) (Picornain 2A) (Protein 2A); Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3A (P3A); Viral protein genome-linked (VPg) (Protein 3B) (P3B); Protein 3CD (EC 3.4.22.28); Protease 3C (P3C) (EC 3.4.22.28); RNA-directed RNA polymerase (RdRp) (EC 2.7.7.48) (3D polymerase) (3Dpol) (Protein 3D) (3D)]
[Ptprb] Receptor-type tyrosine-protein phosphatase beta (Protein-tyrosine phosphatase beta) (R-PTP-beta) (EC 3.1.3.48) (Vascular endothelial protein tyrosine phosphatase) (VE-PTP)
[Ptprs] Receptor-type tyrosine-protein phosphatase S (R-PTP-S) (EC 3.1.3.48) (PTPNU-3) (Receptor-type tyrosine-protein phosphatase sigma) (R-PTP-sigma)
[Ptpn2 Ptpt] Tyrosine-protein phosphatase non-receptor type 2 (Protein-tyrosine phosphatase PTP-2) (EC 3.1.3.48) (MPTP)
[Ptprj Byp Scc1] Receptor-type tyrosine-protein phosphatase eta (Protein-tyrosine phosphatase eta) (R-PTP-eta) (EC 3.1.3.48) (HPTP beta-like tyrosine phosphatase) (Protein-tyrosine phosphatase receptor type J) (R-PTP-J) (Susceptibility to colon cancer 1) (CD antigen CD148)
[PTPRJ DEP1] Receptor-type tyrosine-protein phosphatase eta (Protein-tyrosine phosphatase eta) (R-PTP-eta) (EC 3.1.3.48) (Density-enhanced phosphatase 1) (DEP-1) (HPTP eta) (Protein-tyrosine phosphatase receptor type J) (R-PTP-J) (CD antigen CD148)
[Ptpn11] Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase SYP) (SH-PTP2) (SHP-2) (Shp2)
[PTPN9] Tyrosine-protein phosphatase non-receptor type 9 (EC 3.1.3.48) (Protein-tyrosine phosphatase MEG2) (PTPase MEG2)
[Ptpre Ptpe] Receptor-type tyrosine-protein phosphatase epsilon (Protein-tyrosine phosphatase epsilon) (R-PTP-epsilon) (EC 3.1.3.48)

Bibliography :
?>