GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Macrophage erythroblast attacher (Cell proliferation-inducing gene 5 protein) (Erythroblast macrophage protein) (Human lung cancer oncogene 10 protein) (HLC-10)

 MAEA_HUMAN              Reviewed;         396 AA.
Q7L5Y9; O95285; Q5JB54; Q6ZRD6; Q9BQ11; Q9H9V6; Q9H9Z4; Q9NW84;
01-MAY-2007, integrated into UniProtKB/Swiss-Prot.
05-JUL-2005, sequence version 1.
13-FEB-2019, entry version 122.
RecName: Full=E3 ubiquitin-protein transferase MAEA;
EC=2.3.2.27 {ECO:0000269|PubMed:29911972};
AltName: Full=Cell proliferation-inducing gene 5 protein {ECO:0000303|Ref.1};
AltName: Full=Erythroblast macrophage protein {ECO:0000303|PubMed:9763581};
AltName: Full=Human lung cancer oncogene 10 protein;
Short=HLC-10;
AltName: Full=Macrophage erythroblast attacher;
AltName: Full=P44EMLP {ECO:0000303|PubMed:17467196};
Name=MAEA;
Synonyms=EMP {ECO:0000303|PubMed:16510120,
ECO:0000303|PubMed:9763581}; ORFNames=HLC10, PIG5 {ECO:0000303|Ref.1};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
Kim J.W.;
"Identification of a human cell proliferation gene 5.";
Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
TISSUE=Embryo, and Thymus;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
NUCLEOTIDE SEQUENCE [MRNA] OF 5-396 (ISOFORM 2), REGION, FUNCTION,
SUBCELLULAR LOCATION, TOPOLOGY, AND TISSUE SPECIFICITY.
PubMed=9763581;
Hanspal M., Smockova Y., Uong Q.;
"Molecular identification and functional characterization of a novel
protein that mediates the attachment of erythroblasts to
macrophages.";
Blood 92:2940-2950(1998).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 9-396 (ISOFORM 1).
Kim J.W.;
"Identification of new human cancer-related gene (HLC-10).";
Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 12-396 (ISOFORM 1).
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[7]
FUNCTION, SUBUNIT, DEVELOPMENTAL STAGE, AND SUBCELLULAR LOCATION.
PubMed=16510120; DOI=10.1016/j.bbrc.2006.02.060;
Bala S., Kumar A., Soni S., Sinha S., Hanspal M.;
"Emp is a component of the nuclear matrix of mammalian cells and
undergoes dynamic rearrangements during cell division.";
Biochem. Biophys. Res. Commun. 342:1040-1048(2006).
[8]
IDENTIFICATION IN THE CTLH COMPLEX, IDENTIFICATION BY MASS
SPECTROMETRY, AND SUBCELLULAR LOCATION.
PubMed=17467196; DOI=10.1016/j.gene.2007.02.032;
Kobayashi N., Yang J., Ueda A., Suzuki T., Tomaru K., Takeno M.,
Okuda K., Ishigatsubo Y.;
"RanBPM, Muskelin, p48EMLP, p44CTLH, and the armadillo-repeat proteins
ARMC8alpha and ARMC8beta are components of the CTLH complex.";
Gene 396:236-247(2007).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[10]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-28, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[11]
SUBCELLULAR LOCATION.
PubMed=24143168; DOI=10.1371/journal.pone.0075217;
Francis O., Han F., Adams J.C.;
"Molecular phylogeny of a RING E3 ubiquitin ligase, conserved in
eukaryotic cells and dominated by homologous components, the
muskelin/RanBPM/CTLH complex.";
PLoS ONE 8:E75217-E75217(2013).
[12]
FUNCTION, IDENTIFICATION IN THE CTLH COMPLEX, IDENTIFICATION BY MASS
SPECTROMETRY, SUBCELLULAR LOCATION, AND UBIQUITINATION.
PubMed=29911972; DOI=10.7554/eLife.35528;
Lampert F., Stafa D., Goga A., Soste M.V., Gilberto S., Olieric N.,
Picotti P., Stoffel M., Peter M.;
"The multi-subunit GID/CTLH E3 ligase promotes proliferation and
targets the transcription factor Hbp1 for degradation.";
Elife 7:0-0(2018).
-!- FUNCTION: Core component of the CTLH E3 ubiquitin-protein ligase
complex that selectively accepts ubiquitin from UBE2H and mediates
ubiquitination and subsequent proteasomal degradation of the
transcription factor HBP1. MAEA and RMND5A are both required for
catalytic activity of the CTLH E3 ubiquitin-protein ligase complex
(PubMed:29911972). MAEA is required for normal cell proliferation
(PubMed:29911972). The CTLH E3 ubiquitin-protein ligase complex is
not required for the degradation of enzymes involved in
gluconeogenesis, such as FBP1 (PubMed:29911972). Plays a role in
erythroblast enucleation during erythrocyte maturation and in the
development of mature macrophages (By similarity). Mediates the
attachment of erythroid cell to mature macrophages; this MAEA-
mediated contact inhibits erythroid cell apoptosis
(PubMed:9763581). Participates in erythroblastic island formation,
which is the functional unit of definitive erythropoiesis.
Associates with F-actin to regulate actin distribution in
erythroblasts and macrophages (By similarity). May contribute to
nuclear architecture and cells division events (Probable).
{ECO:0000250|UniProtKB:Q4VC33, ECO:0000269|PubMed:29911972,
ECO:0000269|PubMed:9763581, ECO:0000305|PubMed:16510120}.
-!- CATALYTIC ACTIVITY:
Reaction=S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-
cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-
conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor
protein]-L-lysine.; EC=2.3.2.27;
Evidence={ECO:0000269|PubMed:29911972};
-!- SUBUNIT: Identified in the CTLH complex that contains GID4, RANBP9
and/or RANBP10, MKLN1, MAEA, RMND5A (or alternatively its paralog
RMND5B), GID8, ARMC8, WDR26 and YPEL5 (PubMed:17467196,
PubMed:29911972). Within this complex, MAEA, RMND5A (or
alternatively its paralog RMND5B), GID8, WDR26, and RANBP9 and/or
RANBP10 form the catalytic core, while GID4, MKLN1, ARMC8 and
YPEL5 have ancillary roles (PubMed:29911972). Interacts with F-
actin (PubMed:16510120). {ECO:0000269|PubMed:16510120,
ECO:0000269|PubMed:17467196, ECO:0000269|PubMed:29911972}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q4VC33}.
Nucleus, nucleoplasm {ECO:0000269|PubMed:17467196,
ECO:0000269|PubMed:24143168, ECO:0000269|PubMed:29911972}. Nucleus
matrix {ECO:0000269|PubMed:16510120}. Cell membrane
{ECO:0000269|PubMed:9763581}. Cytoplasm, cytoskeleton
{ECO:0000269|PubMed:16510120}. Note=Detected in a nuclear,
speckled-like pattern (PubMed:16510120). Localized with condensed
chromatin at prophase; Detected in nuclear spindle poles at
metaphase and in the contractile ring during telophase and
cytokinesis (PubMed:16510120). Present in cytoplasm, nuclear
matrix and at the cell surface in macrophages; predominantly
nuclear in immature macrophages and predominantly detected at the
cell surface in mature macrophages. Colocalizes with F-actin in
macrophages (By similarity). {ECO:0000250|UniProtKB:Q4VC33,
ECO:0000269|PubMed:16510120}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1;
IsoId=Q7L5Y9-1; Sequence=Displayed;
Name=2;
IsoId=Q7L5Y9-2; Sequence=VSP_024786, VSP_024790;
Name=3;
IsoId=Q7L5Y9-3; Sequence=VSP_024786;
Name=4;
IsoId=Q7L5Y9-4; Sequence=VSP_024784, VSP_024788;
Note=No experimental confirmation available.;
Name=5;
IsoId=Q7L5Y9-5; Sequence=VSP_024785, VSP_024789;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
-!- TISSUE SPECIFICITY: Detected at macrophage membranes (at protein
level). Ubiquitous. {ECO:0000269|PubMed:9763581}.
-!- DOMAIN: The expected RING-type zinc finger domain is highly
divergent and most of the expected Cys residues are not conserved
(Probable). Still, the protein is required for CTLH complex E3
ubiquitin-protein transferase activity (PubMed:29911972). In
addition, the conserved Cys-314 in this highly divergent region is
required for ubiquitination by the yeast GID complex, suggesting a
direct role in catalyzing ubiquitination (Probable).
{ECO:0000269|PubMed:29911972, ECO:0000305}.
-!- PTM: Autoubiquitinated as component of the CTLH E3 ubiquitin-
protein ligase complex (in vitro). {ECO:0000269|PubMed:29911972}.
-!- SEQUENCE CAUTION:
Sequence=AAC67543.1; Type=Erroneous termination; Positions=397; Note=Translated as stop.; Evidence={ECO:0000305};
Sequence=AAC67543.1; Type=Frameshift; Positions=253, 327; Evidence={ECO:0000305};
Sequence=AAC67543.1; Type=Miscellaneous discrepancy; Note=Sequence differs at N-terminus.; Evidence={ECO:0000305};
Sequence=AAO85220.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=AK128302; Type=Miscellaneous discrepancy; Note=Intron retention.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AY236486; AAP74806.1; -; mRNA.
EMBL; AK001088; BAA91499.1; -; mRNA.
EMBL; AK128302; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AK022515; BAB14072.1; -; mRNA.
EMBL; AK022586; BAB14113.1; -; mRNA.
EMBL; BC001225; AAH01225.2; -; mRNA.
EMBL; BC006470; AAH06470.2; -; mRNA.
EMBL; AF084928; AAC67543.1; ALT_SEQ; mRNA.
EMBL; AY189687; AAO85220.1; ALT_INIT; mRNA.
EMBL; BT006957; AAP35603.1; -; mRNA.
CCDS; CCDS33936.1; -. [Q7L5Y9-1]
CCDS; CCDS33937.1; -. [Q7L5Y9-3]
CCDS; CCDS77887.1; -. [Q7L5Y9-4]
RefSeq; NP_001017405.1; NM_001017405.2. [Q7L5Y9-1]
RefSeq; NP_001284360.1; NM_001297431.1.
RefSeq; NP_005873.2; NM_005882.4. [Q7L5Y9-3]
UniGene; Hs.139896; -.
ProteinModelPortal; Q7L5Y9; -.
SMR; Q7L5Y9; -.
BioGrid; 115584; 76.
CORUM; Q7L5Y9; -.
IntAct; Q7L5Y9; 17.
STRING; 9606.ENSP00000302830; -.
DrugBank; DB05389; WF10.
iPTMnet; Q7L5Y9; -.
PhosphoSitePlus; Q7L5Y9; -.
BioMuta; MAEA; -.
DMDM; 74754297; -.
EPD; Q7L5Y9; -.
jPOST; Q7L5Y9; -.
MaxQB; Q7L5Y9; -.
PaxDb; Q7L5Y9; -.
PeptideAtlas; Q7L5Y9; -.
PRIDE; Q7L5Y9; -.
ProteomicsDB; 68819; -.
ProteomicsDB; 68820; -. [Q7L5Y9-2]
ProteomicsDB; 68821; -. [Q7L5Y9-3]
ProteomicsDB; 68822; -. [Q7L5Y9-4]
ProteomicsDB; 68823; -. [Q7L5Y9-5]
DNASU; 10296; -.
Ensembl; ENST00000264750; ENSP00000264750; ENSG00000090316. [Q7L5Y9-3]
Ensembl; ENST00000303400; ENSP00000302830; ENSG00000090316. [Q7L5Y9-1]
GeneID; 10296; -.
KEGG; hsa:10296; -.
UCSC; uc003gda.4; human. [Q7L5Y9-1]
CTD; 10296; -.
DisGeNET; 10296; -.
EuPathDB; HostDB:ENSG00000090316.15; -.
GeneCards; MAEA; -.
HGNC; HGNC:13731; MAEA.
HPA; HPA036886; -.
HPA; HPA058185; -.
MIM; 606801; gene.
neXtProt; NX_Q7L5Y9; -.
OpenTargets; ENSG00000090316; -.
PharmGKB; PA30533; -.
eggNOG; KOG0396; Eukaryota.
eggNOG; ENOG410XPGU; LUCA.
GeneTree; ENSGT00940000153203; -.
HOVERGEN; HBG053270; -.
InParanoid; Q7L5Y9; -.
KO; K18624; -.
OrthoDB; 243316at2759; -.
PhylomeDB; Q7L5Y9; -.
TreeFam; TF314273; -.
ChiTaRS; MAEA; human.
GenomeRNAi; 10296; -.
PRO; PR:Q7L5Y9; -.
Proteomes; UP000005640; Chromosome 4.
Bgee; ENSG00000090316; Expressed in 227 organ(s), highest expression level in blood.
ExpressionAtlas; Q7L5Y9; baseline and differential.
Genevisible; Q7L5Y9; HS.
GO; GO:0005826; C:actomyosin contractile ring; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; IBA:GO_Central.
GO; GO:0005856; C:cytoskeleton; IDA:UniProtKB.
GO; GO:0034657; C:GID complex; IBA:GO_Central.
GO; GO:0005887; C:integral component of plasma membrane; IDA:UniProtKB.
GO; GO:0016363; C:nuclear matrix; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; IDA:UniProtKB.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0005819; C:spindle; IDA:UniProtKB.
GO; GO:0000151; C:ubiquitin ligase complex; IDA:UniProtKB.
GO; GO:0003779; F:actin binding; IDA:UniProtKB.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0016740; F:transferase activity; IEA:UniProtKB-KW.
GO; GO:0007155; P:cell adhesion; IDA:UniProtKB.
GO; GO:0007049; P:cell cycle; IEA:UniProtKB-KW.
GO; GO:0051301; P:cell division; IEA:UniProtKB-KW.
GO; GO:0007010; P:cytoskeleton organization; IEA:Ensembl.
GO; GO:0048822; P:enucleate erythrocyte development; IEA:Ensembl.
GO; GO:0043249; P:erythrocyte maturation; IEA:UniProtKB-KW.
GO; GO:0043066; P:negative regulation of apoptotic process; IBA:GO_Central.
GO; GO:0045721; P:negative regulation of gluconeogenesis; IEA:InterPro.
GO; GO:0033033; P:negative regulation of myeloid cell apoptotic process; IDA:UniProtKB.
GO; GO:0043161; P:proteasome-mediated ubiquitin-dependent protein catabolic process; IBA:GO_Central.
GO; GO:0016567; P:protein ubiquitination; IEA:GOC.
GO; GO:0007346; P:regulation of mitotic cell cycle; NAS:UniProtKB.
GO; GO:0006511; P:ubiquitin-dependent protein catabolic process; IBA:GO_Central.
InterPro; IPR013144; CRA_dom.
InterPro; IPR024964; CTLH/CRA.
InterPro; IPR006595; CTLH_C.
InterPro; IPR027714; Fyv10/EMP.
InterPro; IPR006594; LisH.
PANTHER; PTHR12170:SF2; PTHR12170:SF2; 1.
Pfam; PF10607; CLTH; 1.
SMART; SM00757; CRA; 1.
SMART; SM00668; CTLH; 1.
SMART; SM00667; LisH; 1.
PROSITE; PS50897; CTLH; 1.
PROSITE; PS50896; LISH; 1.
PROSITE; PS51867; ZF_RING_GID; 1.
1: Evidence at protein level;
Actin-binding; Alternative splicing; Cell cycle; Cell division;
Cell membrane; Complete proteome; Cytoplasm; Cytoskeleton;
Erythrocyte maturation; Membrane; Metal-binding; Nucleus;
Phosphoprotein; Polymorphism; Reference proteome; Transferase;
Ubl conjugation; Ubl conjugation pathway; Zinc; Zinc-finger.
CHAIN 1 396 E3 ubiquitin-protein transferase MAEA.
/FTId=PRO_0000284936.
DOMAIN 121 153 LisH. {ECO:0000255|PROSITE-
ProRule:PRU00126}.
DOMAIN 159 216 CTLH. {ECO:0000255|PROSITE-
ProRule:PRU00058}.
ZN_FING 314 381 RING-Gid-type. {ECO:0000255|PROSITE-
ProRule:PRU01215}.
REGION 1 124 Extracellular and involved in cell to
cell contact.
{ECO:0000269|PubMed:9763581}.
SITE 314 314 Essential for ubiquitin ligase activity.
{ECO:0000250|UniProtKB:P40492}.
MOD_RES 28 28 Phosphothreonine.
{ECO:0000244|PubMed:23186163}.
VAR_SEQ 152 232 EDLVNIEMFLTAKEVEESLERRETATCLAWCHDNKSRLRKM
KSCLEFSLRIQEFIELIRQNKRLDAVRHARKHFSQAEGSQ
-> GTCKKALQPSRREPAGRGAPGHGHAGLPARHAHLPVQG
PSGPCTVADADPAVPVRQLPTTPAGKQFCVHPHPAGWPLSH
QD (in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_024784.
VAR_SEQ 153 245 DLVNIEMFLTAKEVEESLERRETATCLAWCHDNKSRLRKMK
SCLEFSLRIQEFIELIRQNKRLDAVRHARKHFSQAEGSQLD
EVRQAMGMLAF -> TCKKALQPSRREPAGRGAPGHGHAGL
PARHAHLPVQGPSGPCTVADADPAVPVRQLPTTPAGKQFCV
HPHPAGRPLSHQDTTVLQGGRQLQEP (in isoform
5). {ECO:0000303|Ref.1}.
/FTId=VSP_024785.
VAR_SEQ 153 193 Missing (in isoform 2 and isoform 3).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:9763581}.
/FTId=VSP_024786.
VAR_SEQ 233 300 Missing (in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_024788.
VAR_SEQ 246 396 Missing (in isoform 5).
{ECO:0000303|Ref.1}.
/FTId=VSP_024789.
VAR_SEQ 265 265 M -> TCTVAD (in isoform 2).
{ECO:0000303|PubMed:9763581}.
/FTId=VSP_024790.
VARIANT 34 34 R -> C (in dbSNP:rs34082974).
/FTId=VAR_051150.
CONFLICT 32 32 R -> C (in Ref. 1; AAP74806).
{ECO:0000305}.
CONFLICT 56 56 K -> R (in Ref. 4; AAC67543).
{ECO:0000305}.
CONFLICT 101 101 R -> L (in Ref. 4; AAC67543).
{ECO:0000305}.
CONFLICT 123 123 K -> R (in Ref. 2; BAA91499).
{ECO:0000305}.
CONFLICT 313 313 D -> V (in Ref. 4; AAC67543).
{ECO:0000305}.
CONFLICT 327 327 P -> R (in Ref. 4; AAC67543).
{ECO:0000305}.
SEQUENCE 396 AA; 45287 MW; 361FB82BE0240C21 CRC64;
MAVQESAAQL SMTLKVQEYP TLKVPYETLN KRFRAAQKNI DRETSHVTMV VAELEKTLSG
CPAVDSVVSL LDGVVEKLSV LKRKAVESIQ AEDESAKLCK RRIEHLKEHS SDQPAAASVW
KRKRMDRMMV EHLLRCGYYN TAVKLARQSG IEDLVNIEMF LTAKEVEESL ERRETATCLA
WCHDNKSRLR KMKSCLEFSL RIQEFIELIR QNKRLDAVRH ARKHFSQAEG SQLDEVRQAM
GMLAFPPDTH ISPYKDLLDP ARWRMLIQQF RYDNYRLHQL GNNSVFTLTL QAGLSAIKTP
QCYKEDGSSK SPDCPVCSRS LNKLAQPLPM AHCANSRLVC KISGDVMNEN NPPMMLPNGY
VYGYNSLLSI RQDDKVVCPR TKEVFHFSQA EKVYIM


Related products :

Catalog number Product name Quantity
MAF MAEA Gene macrophage erythroblast attacher
MAEA_MOUSE ELISA Kit FOR Macrophage erythroblast attacher; organism: Mouse; gene name: Maea 96T
E1568m Human ELISA Kit FOR Macrophage erythroblast attacher 96T
pro-1634 Recombinant Human Macrophage Erythroblast Attacher 2
pro-1634 Recombinant Human Macrophage Erythroblast Attacher 1mg
pro-1634 Recombinant Human Macrophage Erythroblast Attacher 10
CSB-EL013310HU Human Macrophage erythroblast attacher(MAEA) ELISA kit 96T
201-12-4190 Human Macrophage Erythroblast Attacher(MAEA)ELISA Kit 96T
UB-E02710 Human Macrophage Erythroblast Attacher(MAEA)ELISA Kit 96T
QY-E02710 Human Macrophage Erythroblast Attacher(MAEA)ELISA Kit 96T
3008 IgG,Macrophage erythroblast attacher 0.1 mg
3009 IgG,Macrophage erythroblast attacher 0.1 mg
3007 IgG,Macrophage erythroblast attacher 0.1 mg
3010 IgG,Macrophage erythroblast attacher 0.1 mg
CSB-EL013310HU Human Macrophage erythroblast attacher(MAEA) ELISA kit SpeciesHuman 96T
GWB-D0D9C6 Macrophage erythroblast attacher, Antibody
GWB-40DA32 Macrophage erythroblast attacher, Antibody
GWB-C251FB Macrophage erythroblast attacher, Antibody
GWB-CBF490 Macrophage erythroblast attacher, Antibody
201-20-3207 MAEA{macrophage erythroblast attacher}rabbit.pAb 0.2ml
MAEA_CHICK Chicken ELISA Kit FOR Macrophage erythroblast attacher 96T
E1018r Bovine ELISA Kit FOR Macrophage erythroblast attacher 96T
E0194r Mouse ELISA Kit FOR Macrophage erythroblast attacher 96T
SOLH1_MOUSE Mouse ELISA Kit FOR Macrophage erythroblast attacher 96T
CSB-EL013310RA Rat Macrophage erythroblast attacher(MAEA) ELISA kit 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1049: G Protein Signaling Pathways
WP1165: G Protein Signaling Pathways
WP1371: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1493: Carbon assimilation C4 pathway
WP1502: Mitochondrial biogenesis
WP1531: Vitamin D synthesis
WP1566: Citrate cycle (TCA cycle)
WP1613: 1,4-Dichlorobenzene degradation
WP1616: ABC transporters
WP1624: Bacterial secretion system
WP1625: Base excision repair
WP1644: DNA replication
WP1650: Fluorobenzoate degradation
WP1654: gamma-Hexachlorocyclohexane degradation
WP1657: Glycerolipid metabolism
WP1659: Glycine, serine and threonine metabolism
WP1661: Glyoxylate and dicarboxylate metabolism
WP1663: Homologous recombination
WP1665: Limonene and pinene degradation
WP1672: Mismatch repair
WP1673: Naphthalene and anthracene degradation
WP1675: Nitrogen metabolism
WP1676: Non-homologous end-joining
WP1678: Nucleotide excision repair

Related Genes :
[MAEA EMP HLC10 PIG5] E3 ubiquitin-protein transferase MAEA (EC 2.3.2.27) (Cell proliferation-inducing gene 5 protein) (Erythroblast macrophage protein) (Human lung cancer oncogene 10 protein) (HLC-10) (Macrophage erythroblast attacher) (P44EMLP)
[RACK1 GNB2L1 HLC7 PIG21] Receptor of activated protein C kinase 1 (Cell proliferation-inducing gene 21 protein) (Guanine nucleotide-binding protein subunit beta-2-like 1) (Guanine nucleotide-binding protein subunit beta-like protein 12.3) (Human lung cancer oncogene 7 protein) (HLC-7) (Receptor for activated C kinase) (Small ribosomal subunit protein RACK1) [Cleaved into: Receptor of activated protein C kinase 1, N-terminally processed (Guanine nucleotide-binding protein subunit beta-2-like 1, N-terminally processed)]
[Maea Emp] E3 ubiquitin-protein transferase MAEA (EC 2.3.2.27) (Erythroblast macrophage protein) (Macrophage erythroblast attacher)
[MST1R PTK8 RON] Macrophage-stimulating protein receptor (MSP receptor) (EC 2.7.10.1) (CDw136) (Protein-tyrosine kinase 8) (p185-Ron) (CD antigen CD136) [Cleaved into: Macrophage-stimulating protein receptor alpha chain; Macrophage-stimulating protein receptor beta chain]
[CSF1R FMS] Macrophage colony-stimulating factor 1 receptor (CSF-1 receptor) (CSF-1-R) (CSF-1R) (M-CSF-R) (EC 2.7.10.1) (Proto-oncogene c-Fms) (CD antigen CD115)
[Mst1r Ron Stk] Macrophage-stimulating protein receptor (MSP receptor) (EC 2.7.10.1) (Stem cell-derived tyrosine kinase) (p185-Ron) (CD antigen CD136) [Cleaved into: Macrophage-stimulating protein receptor alpha chain; Macrophage-stimulating protein receptor beta chain]
[Csf1r Csfmr Fms] Macrophage colony-stimulating factor 1 receptor (CSF-1 receptor) (CSF-1-R) (CSF-1R) (M-CSF-R) (EC 2.7.10.1) (Proto-oncogene c-Fms) (CD antigen CD115)
[ERBB2 HER2 MLN19 NEU NGL] Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340)
[Maea] E3 ubiquitin-protein transferase MAEA (EC 2.3.2.27) (Macrophage erythroblast attacher)
[MAEA] E3 ubiquitin-protein transferase MAEA (EC 2.3.2.27) (Macrophage erythroblast attacher)
[GOLGA5 RETII RFG5 PIG31] Golgin subfamily A member 5 (Cell proliferation-inducing gene 31 protein) (Golgin-84) (Protein Ret-II) (RET-fused gene 5 protein)
[NRG1 GGF HGL HRGA NDF SMDF] Pro-neuregulin-1, membrane-bound isoform (Pro-NRG1) [Cleaved into: Neuregulin-1 (Acetylcholine receptor-inducing activity) (ARIA) (Breast cancer cell differentiation factor p45) (Glial growth factor) (Heregulin) (HRG) (Neu differentiation factor) (Sensory and motor neuron-derived factor)]
[MAEA RCJMB04_26n5] E3 ubiquitin-protein transferase MAEA (EC 2.3.2.27) (Macrophage erythroblast attacher)
[EGFR ERBB ERBB1 HER1] Epidermal growth factor receptor (EC 2.7.10.1) (Proto-oncogene c-ErbB-1) (Receptor tyrosine-protein kinase erbB-1)
[CSF1R FMS] Macrophage colony-stimulating factor 1 receptor (CSF-1 receptor) (CSF-1-R) (CSF-1R) (M-CSF-R) (EC 2.7.10.1) (Proto-oncogene c-Fms) (CD antigen CD115)
[Csf1r Csfmr Fms] Macrophage colony-stimulating factor 1 receptor (CSF-1 receptor) (CSF-1-R) (CSF-1R) (M-CSF-R) (EC 2.7.10.1) (Proto-oncogene c-Fms) (CD antigen CD115)
[PDS5A KIAA0648 PDS5 PIG54] Sister chromatid cohesion protein PDS5 homolog A (Cell proliferation-inducing gene 54 protein) (Sister chromatid cohesion protein 112) (SCC-112)
[CSF1] Macrophage colony-stimulating factor 1 (CSF-1) (M-CSF) (MCSF) (Lanimostim) [Cleaved into: Processed macrophage colony-stimulating factor 1]
[ERBB4 HER4] Receptor tyrosine-protein kinase erbB-4 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-4) (Tyrosine kinase-type cell surface receptor HER4) (p180erbB4) [Cleaved into: ERBB4 intracellular domain (4ICD) (E4ICD) (s80HER4)]
[RET CDHF12 CDHR16 PTC RET51] Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment]
[AKAP13 BRX HT31 LBC] A-kinase anchor protein 13 (AKAP-13) (AKAP-Lbc) (Breast cancer nuclear receptor-binding auxiliary protein) (Guanine nucleotide exchange factor Lbc) (Human thyroid-anchoring protein 31) (Lymphoid blast crisis oncogene) (LBC oncogene) (Non-oncogenic Rho GTPase-specific GTP exchange factor) (Protein kinase A-anchoring protein 13) (PRKA13) (p47)
[MRC1 CLEC13D CLEC13DL MRC1L1] Macrophage mannose receptor 1 (MMR) (C-type lectin domain family 13 member D) (C-type lectin domain family 13 member D-like) (Human mannose receptor) (hMR) (Macrophage mannose receptor 1-like protein 1) (CD antigen CD206)
[KIT SCFR] Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Piebald trait protein) (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD antigen CD117)
[FER TYK3] Tyrosine-protein kinase Fer (EC 2.7.10.2) (Feline encephalitis virus-related kinase FER) (Fujinami poultry sarcoma/Feline sarcoma-related protein Fer) (Proto-oncogene c-Fer) (Tyrosine kinase 3) (p94-Fer)
[NFKB2 LYT10] Nuclear factor NF-kappa-B p100 subunit (DNA-binding factor KBF2) (H2TF1) (Lymphocyte translocation chromosome 10 protein) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2) (Oncogene Lyt-10) (Lyt10) [Cleaved into: Nuclear factor NF-kappa-B p52 subunit]
[CCL18 AMAC1 DCCK1 MIP4 PARC SCYA18] C-C motif chemokine 18 (Alternative macrophage activation-associated CC chemokine 1) (AMAC-1) (CC chemokine PARC) (Dendritic cell chemokine 1) (DC-CK1) (Macrophage inflammatory protein 4) (MIP-4) (Pulmonary and activation-regulated chemokine) (Small-inducible cytokine A18) [Cleaved into: CCL18(1-68); CCL18(3-69); CCL18(4-69)]
[SERPINF1 PEDF PIG35] Pigment epithelium-derived factor (PEDF) (Cell proliferation-inducing gene 35 protein) (EPC-1) (Serpin F1)
[RAF1 RAF] RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (Proto-oncogene c-RAF) (cRaf) (Raf-1)
[ROS1 MCF3 ROS] Proto-oncogene tyrosine-protein kinase ROS (EC 2.7.10.1) (Proto-oncogene c-Ros) (Proto-oncogene c-Ros-1) (Receptor tyrosine kinase c-ros oncogene 1) (c-Ros receptor tyrosine kinase)
[RAC1 TC25 MIG5] Ras-related C3 botulinum toxin substrate 1 (Cell migration-inducing gene 5 protein) (Ras-like protein TC25) (p21-Rac1)

Bibliography :