GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Noelin (Neuronal olfactomedin-related ER localized protein) (Olfactomedin-1) (Pancortin)

 NOE1_MOUSE              Reviewed;         485 AA.
O88998; A3KGE5; O35429; O88999; Q91XK8; Q9QWQ9; Q9QWR0;
21-FEB-2001, integrated into UniProtKB/Swiss-Prot.
01-NOV-1998, sequence version 1.
13-FEB-2019, entry version 152.
RecName: Full=Noelin;
AltName: Full=Neuronal olfactomedin-related ER localized protein;
AltName: Full=Olfactomedin-1 {ECO:0000303|PubMed:25903135};
AltName: Full=Pancortin {ECO:0000303|PubMed:9473566};
Flags: Precursor;
Name=Olfm1; Synonyms=Noe1, Noel, Noel1;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY,
AND SUBCELLULAR LOCATION.
STRAIN=ICR; TISSUE=Brain;
PubMed=9473566; DOI=10.1016/S0169-328X(97)00271-4;
Nagano T., Nakamura A., Mori Y., Maeda M., Takami T., Shiosaka S.,
Takagi H., Sato M.;
"Differentially expressed olfactomedin-related glycoproteins
(Pancortins) in the brain.";
Brain Res. Mol. Brain Res. 53:13-23(1998).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Anholt R., Kulkarni N., Karavanich C.;
Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
STRAIN=C57BL/6J; TISSUE=Brain;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=C57BL/6J;
PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
Lindblad-Toh K., Eichler E.E., Ponting C.P.;
"Lineage-specific biology revealed by a finished genome assembly of
the mouse.";
PLoS Biol. 7:E1000112-E1000112(2009).
[5]
DEVELOPMENTAL STAGE.
PubMed=21228389; DOI=10.1167/iovs.10-6356;
Sultana A., Nakaya N., Senatorov V.V., Tomarev S.I.;
"Olfactomedin 2: expression in the eye and interaction with other
olfactomedin domain-containing proteins.";
Invest. Ophthalmol. Vis. Sci. 52:2584-2592(2011).
[6]
FUNCTION, INTERACTION WITH RTN4R, IDENTIFICATION IN A COMPLEX WITH
RTN4R AND LINGO1, AND SUBCELLULAR LOCATION.
PubMed=22923615; DOI=10.1074/jbc.M112.389916;
Nakaya N., Sultana A., Lee H.S., Tomarev S.I.;
"Olfactomedin 1 interacts with the Nogo A receptor complex to regulate
axon growth.";
J. Biol. Chem. 287:37171-37184(2012).
[7]
IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, AND TISSUE
SPECIFICITY.
PubMed=22632720; DOI=10.1016/j.neuron.2012.03.034;
Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H.,
Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N.,
Schulte U., Fakler B.;
"High-resolution proteomics unravel architecture and molecular
diversity of native AMPA receptor complexes.";
Neuron 74:621-633(2012).
[8]
DISRUPTION PHENOTYPE, FUNCTION, DEVELOPMENTAL STAGE, TISSUE
SPECIFICITY, AND SUBCELLULAR LOCATION.
PubMed=26107991; DOI=10.1210/en.2015-1389;
Li R., Diao H., Zhao F., Xiao S., Zowalaty A.E., Dudley E.A.,
Mattson M.P., Ye X.;
"Olfactomedin 1 deficiency leads to defective olfaction and impaired
female fertility.";
Endocrinology 2015:EN20151389-EN20151389(2015).
[9]
X-RAY CRYSTALLOGRAPHY (2.40 ANGSTROMS) OF 211-478, STRUCTURE BY
ELECTRON MICROSCOPY, COILED COIL, DOMAIN, SUBUNIT, DISULFIDE BONDS,
GLYCOSYLATION AT ASN-307; ASN-394 AND ASN-473, SUBCELLULAR LOCATION,
AND MUTAGENESIS OF 479-VAL--LEU-485.
PubMed=25903135; DOI=10.1074/jbc.M115.653485;
Pronker M.F., Bos T.G., Sharp T.H., Thies-Weesie D.M., Janssen B.J.;
"Olfactomedin-1 has a v-shaped disulfide-linked tetrameric
Structure.";
J. Biol. Chem. 290:15092-15101(2015).
-!- FUNCTION: Contributes to the regulation of axonal growth in the
embryonic and adult central nervous system by inhibiting
interactions between RTN4R and LINGO1. Inhibits RTN4R-mediated
axon growth cone collapse (PubMed:22923615). May play an important
role in regulating the production of neural crest cells by the
neural tube (By similarity). May be required for normal responses
to olfactory stimuli (PubMed:26107991).
{ECO:0000250|UniProtKB:Q9IAK4, ECO:0000269|PubMed:22923615,
ECO:0000269|PubMed:26107991}.
-!- SUBUNIT: Homotetramer; disulfide-linked. Dimer of dimers, giving
rise to a V-shaped homotretramer (PubMed:25903135). Isoform 1 and
isoform 3 interact with RTN4R (PubMed:22923615). Identified in a
complex with RTN4R and LINGO1 (PubMed:22923615). Peripherally
associated with AMPAR complex. AMPAR complex consists of an inner
core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2,
GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a
twofold symmetry. One of the two pairs of distinct binding sites
is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other
harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core
of AMPAR complex is complemented by outer core constituents
binding directly to the GluA/GRIA proteins at sites distinct from
the interaction sites of the inner core constituents. Outer core
constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L
and NRN1. The proteins of the inner and outer core serve as a
platform for other, more peripherally associated AMPAR
constituents, including OLFM1. Alone or in combination, these
auxiliary subunits control the gating and pharmacology of the
AMPAR complex and profoundly impact their biogenesis and protein
processing (PubMed:22632720). Interacts with OLFM2 (By
similarity). {ECO:0000250|UniProtKB:Q99784,
ECO:0000269|PubMed:22632720, ECO:0000269|PubMed:22923615,
ECO:0000269|PubMed:25903135}.
-!- SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:22923615,
ECO:0000305|PubMed:22632720}. Cell junction, synapse
{ECO:0000305|PubMed:22632720}. Endoplasmic reticulum
{ECO:0000269|PubMed:22923615}. Cell projection, axon
{ECO:0000269|PubMed:22923615, ECO:0000269|PubMed:26107991}.
Perikaryon {ECO:0000269|PubMed:22923615}.
-!- SUBCELLULAR LOCATION: Isoform 1: Endoplasmic reticulum
{ECO:0000269|PubMed:9473566, ECO:0000305|PubMed:25903135}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=BMZ. {ECO:0000305};
IsoId=O88998-1; Sequence=Displayed;
Name=2; Synonyms=BMY. {ECO:0000305};
IsoId=O88998-2; Sequence=VSP_003763, VSP_003764;
Name=3; Synonyms=AMZ {ECO:0000305};
IsoId=O88998-3; Sequence=VSP_003762;
Name=4; Synonyms=AMY {ECO:0000305};
IsoId=O88998-4; Sequence=VSP_003762, VSP_003763, VSP_003764;
-!- TISSUE SPECIFICITY: Expressed in the brain cortex, olfactory bulb
and vomeronasal neuroepithelium (at protein level)
(PubMed:9473566, PubMed:26107991, PubMed:22923615,
PubMed:22632720). Detected in brain cortex, hippocampus, dorsal
root ganglion and olfactory bulb (PubMed:9473566,
PubMed:22923615). {ECO:0000269|PubMed:22632720,
ECO:0000269|PubMed:22923615, ECO:0000269|PubMed:26107991,
ECO:0000269|PubMed:9473566}.
-!- DEVELOPMENTAL STAGE: Expression increases moderately during
embryonic development and remains stable in the postnatal brain
(PubMed:21228389). Highly expressed in uterus luminal epithelium
after embryo implantation (PubMed:26107991).
{ECO:0000269|PubMed:21228389, ECO:0000269|PubMed:26107991}.
-!- DOMAIN: The protein contains a globular N-terminal tetramerization
domain, a long stalk formed by the coiled coil region and a C-
terminal olfactomedin-like domain. Interactions between dimers are
mediated by the coiled coil region. The dimers interact mostly via
the N-terminal tetramerization domain, giving rise to a V-shaped
overall architecture of the tetramer.
{ECO:0000269|PubMed:25903135}.
-!- DISRUPTION PHENOTYPE: Females have slightly lower body weight than
wild-type at birth, but strongly reduced body weight one to eight
weeks after birth. Mutant females do not display normal estrus
cycle responses to male odor, and have very low fertility due to a
strongly decreased rate of ovulation and a low mating rate.
{ECO:0000269|PubMed:25903135}.
-!- MISCELLANEOUS: The protein structure is stabilized by calcium
ions. {ECO:0000269|PubMed:25903135}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; D78262; BAA28765.1; -; mRNA.
EMBL; D78263; BAA28766.1; -; mRNA.
EMBL; D78264; BAA28767.1; -; mRNA.
EMBL; D78265; BAA28764.1; -; mRNA.
EMBL; AF028740; AAB84058.1; -; mRNA.
EMBL; AK003031; BAB22520.1; -; mRNA.
EMBL; AL731778; -; NOT_ANNOTATED_CDS; Genomic_DNA.
CCDS; CCDS15833.1; -. [O88998-3]
CCDS; CCDS15834.1; -. [O88998-1]
CCDS; CCDS15835.1; -. [O88998-2]
RefSeq; NP_001033701.1; NM_001038612.1. [O88998-2]
RefSeq; NP_001033703.1; NM_001038614.1. [O88998-4]
UniGene; Mm.43278; -.
PDB; 5AMO; X-ray; 2.40 A; A/B=17-478.
PDBsum; 5AMO; -.
DisProt; DP00936; -.
ProteinModelPortal; O88998; -.
SMR; O88998; -.
BioGrid; 207823; 1.
CORUM; O88998; -.
IntAct; O88998; 1.
STRING; 10090.ENSMUSP00000028177; -.
iPTMnet; O88998; -.
PhosphoSitePlus; O88998; -.
MaxQB; O88998; -.
PaxDb; O88998; -.
PeptideAtlas; O88998; -.
PRIDE; O88998; -.
Ensembl; ENSMUST00000102879; ENSMUSP00000099943; ENSMUSG00000026833. [O88998-2]
GeneID; 56177; -.
KEGG; mmu:56177; -.
UCSC; uc008iya.1; mouse. [O88998-4]
UCSC; uc008iyc.1; mouse. [O88998-2]
CTD; 10439; -.
MGI; MGI:1860437; Olfm1.
eggNOG; ENOG410INP4; Eukaryota.
eggNOG; ENOG41104PB; LUCA.
GeneTree; ENSGT00940000156959; -.
HOVERGEN; HBG006513; -.
InParanoid; O88998; -.
OrthoDB; 421994at2759; -.
PhylomeDB; O88998; -.
ChiTaRS; Olfm1; mouse.
PRO; PR:O88998; -.
Proteomes; UP000000589; Chromosome 2.
Bgee; ENSMUSG00000026833; Expressed in 326 organ(s), highest expression level in prefrontal cortex.
ExpressionAtlas; O88998; baseline and differential.
Genevisible; O88998; MM.
GO; GO:0032281; C:AMPA glutamate receptor complex; IDA:MGI.
GO; GO:0030424; C:axon; IDA:UniProtKB.
GO; GO:0044295; C:axonal growth cone; IDA:UniProtKB.
GO; GO:0030054; C:cell junction; IEA:UniProtKB-KW.
GO; GO:0005783; C:endoplasmic reticulum; IDA:UniProtKB.
GO; GO:0005615; C:extracellular space; IDA:MGI.
GO; GO:0099243; C:extrinsic component of synaptic membrane; IDA:SynGO.
GO; GO:0098978; C:glutamatergic synapse; IDA:SynGO.
GO; GO:0043025; C:neuronal cell body; IDA:UniProtKB.
GO; GO:0043204; C:perikaryon; IEA:UniProtKB-SubCell.
GO; GO:0097060; C:synaptic membrane; IDA:MGI.
GO; GO:0001540; F:amyloid-beta binding; IDA:MGI.
GO; GO:0003190; P:atrioventricular valve formation; ISS:AgBase.
GO; GO:0060317; P:cardiac epithelial to mesenchymal transition; ISS:AgBase.
GO; GO:1902430; P:negative regulation of amyloid-beta formation; IDA:MGI.
GO; GO:0010629; P:negative regulation of gene expression; ISS:AgBase.
GO; GO:2001223; P:negative regulation of neuron migration; IDA:MGI.
GO; GO:0023041; P:neuronal signal transduction; IDA:UniProtKB.
GO; GO:0010718; P:positive regulation of epithelial to mesenchymal transition; ISS:AgBase.
GO; GO:0010628; P:positive regulation of gene expression; ISS:AgBase.
GO; GO:0051259; P:protein complex oligomerization; IDA:MGI.
GO; GO:1902003; P:regulation of amyloid-beta formation; IDA:MGI.
GO; GO:0030516; P:regulation of axon extension; IDA:UniProtKB.
InterPro; IPR031217; Noelin.
InterPro; IPR022082; Noelin_dom.
InterPro; IPR003112; Olfac-like_dom.
InterPro; IPR011044; Quino_amine_DH_bsu.
PANTHER; PTHR23192:SF34; PTHR23192:SF34; 1.
Pfam; PF12308; Noelin-1; 1.
Pfam; PF02191; OLF; 1.
SMART; SM00284; OLF; 1.
SUPFAM; SSF50969; SSF50969; 1.
PROSITE; PS00014; ER_TARGET; 1.
PROSITE; PS51132; OLF; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cell junction; Cell projection;
Coiled coil; Complete proteome; Developmental protein; Disulfide bond;
Endoplasmic reticulum; Glycoprotein; Reference proteome; Secreted;
Signal; Synapse.
SIGNAL 1 16 {ECO:0000255}.
CHAIN 17 485 Noelin.
/FTId=PRO_0000020075.
DOMAIN 226 478 Olfactomedin-like. {ECO:0000255|PROSITE-
ProRule:PRU00446}.
COILED 87 227 {ECO:0000255,
ECO:0000305|PubMed:25903135}.
MOTIF 482 485 Endoplasmic reticulum retention signal.
{ECO:0000305|PubMed:25903135}.
CARBOHYD 33 33 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 103 103 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 187 187 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 288 288 N-linked (GlcNAc...) asparagine.
{ECO:0000255,
ECO:0000305|PubMed:25903135}.
CARBOHYD 307 307 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:5AMO, ECO:0000255,
ECO:0000269|PubMed:25903135}.
CARBOHYD 394 394 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:5AMO, ECO:0000255,
ECO:0000269|PubMed:25903135}.
CARBOHYD 431 431 N-linked (GlcNAc...) asparagine.
{ECO:0000255,
ECO:0000305|PubMed:25903135}.
CARBOHYD 473 473 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:5AMO, ECO:0000255,
ECO:0000269|PubMed:25903135}.
DISULFID 221 221 Interchain. {ECO:0000244|PDB:5AMO,
ECO:0000269|PubMed:25903135}.
DISULFID 227 409 {ECO:0000244|PDB:5AMO,
ECO:0000255|PROSITE-ProRule:PRU00446,
ECO:0000269|PubMed:25903135}.
VAR_SEQ 1 50 MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAAS
GGTLDRSTG -> MQPARKLLSLLVLLVMGTELTQ (in
isoform 3 and isoform 4).
{ECO:0000303|PubMed:16141072,
ECO:0000303|Ref.2}.
/FTId=VSP_003762.
VAR_SEQ 153 153 A -> G (in isoform 2 and isoform 4).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_003763.
VAR_SEQ 154 485 Missing (in isoform 2 and isoform 4).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_003764.
MUTAGEN 479 485 Missing: Abolishes retention in the
endoplasmic reticulum so that the protein
is secreted.
{ECO:0000269|PubMed:25903135}.
CONFLICT 69 69 S -> M (in Ref. 2; AAB84058).
{ECO:0000305}.
CONFLICT 329 329 A -> M (in Ref. 2; AAB84058).
{ECO:0000305}.
CONFLICT 429 429 Q -> R (in Ref. 2; AAB84058).
{ECO:0000305}.
HELIX 212 225 {ECO:0000244|PDB:5AMO}.
STRAND 230 233 {ECO:0000244|PDB:5AMO}.
STRAND 237 241 {ECO:0000244|PDB:5AMO}.
STRAND 245 250 {ECO:0000244|PDB:5AMO}.
STRAND 262 266 {ECO:0000244|PDB:5AMO}.
STRAND 268 270 {ECO:0000244|PDB:5AMO}.
STRAND 273 279 {ECO:0000244|PDB:5AMO}.
HELIX 280 285 {ECO:0000244|PDB:5AMO}.
STRAND 290 293 {ECO:0000244|PDB:5AMO}.
STRAND 298 301 {ECO:0000244|PDB:5AMO}.
STRAND 304 306 {ECO:0000244|PDB:5AMO}.
STRAND 309 314 {ECO:0000244|PDB:5AMO}.
STRAND 317 324 {ECO:0000244|PDB:5AMO}.
TURN 325 328 {ECO:0000244|PDB:5AMO}.
STRAND 329 335 {ECO:0000244|PDB:5AMO}.
STRAND 355 360 {ECO:0000244|PDB:5AMO}.
STRAND 363 369 {ECO:0000244|PDB:5AMO}.
TURN 371 374 {ECO:0000244|PDB:5AMO}.
STRAND 375 382 {ECO:0000244|PDB:5AMO}.
TURN 384 386 {ECO:0000244|PDB:5AMO}.
STRAND 389 398 {ECO:0000244|PDB:5AMO}.
TURN 399 401 {ECO:0000244|PDB:5AMO}.
STRAND 405 416 {ECO:0000244|PDB:5AMO}.
STRAND 418 421 {ECO:0000244|PDB:5AMO}.
STRAND 423 429 {ECO:0000244|PDB:5AMO}.
TURN 430 433 {ECO:0000244|PDB:5AMO}.
STRAND 434 436 {ECO:0000244|PDB:5AMO}.
STRAND 450 455 {ECO:0000244|PDB:5AMO}.
TURN 456 459 {ECO:0000244|PDB:5AMO}.
STRAND 460 464 {ECO:0000244|PDB:5AMO}.
STRAND 466 476 {ECO:0000244|PDB:5AMO}.
SEQUENCE 485 AA; 55398 MW; 6429574ECD814944 CRC64;
MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTRLSAA SGGTLDRSTG VLPTNPEESW
QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK VQNMSQSIEV LDRRTQRDLQ
YVEKMENQMK GLETKFKQVE ESHKQHLARQ FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ
FKEEVQNLTS VLNELQEEIG AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK
TSGSRFGSWM TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG
TGQVVYNGSI YFNKFQSHII IRFDLKTEAI LKTRSLDYAG YNNMYHYAWG GHSDIDLMVD
ENGLWAVYAT NQNAGNIVIS KLDPVSLQIL QTWNTSYPKR SAGEAFIICG TLYVTNGYSG
GTKVHYAYQT NASTYEYIDI PFQNKYSHIS MLDYNPKDRA LYAWNNGHQT LYNVTLFHVI
RSDEL


Related products :

Catalog number Product name Quantity
EIAAB27468 Mouse,Mus musculus,Neuronal olfactomedin-related ER localized protein,Noe1,Noel,Noel1,Noelin,Olfactomedin-1,Olfm1,Pancortin
EIAAB27470 1B426B,D2Sut1e,Neuronal olfactomedin-related ER localized protein,Noe1,Noel,Noel1,Noelin,Olfactomedin-1,Olfm1,Pancortin,Rat,Rattus norvegicus
EIAAB27467 Chicken,Gallus gallus,Neuronal olfactomedin-related ER localized protein,NOEL,NOEL1,Noelin,Olfactomedin-1,OLFM1,Pancortin
EIAAB27469 Homo sapiens,Human,Neuronal olfactomedin-related ER localized protein,NOE1,NOEL1,Noelin,Olfactomedin-1,OLFM1
EIAAB28816 Chicken,Gallus gallus,Olfactomedin-like protein 3,Olfactomedin-noelin-tiarin factor 1,OLFML3,ONT1
EIAAB27471 Mouse,Mus musculus,Noelin-2,Olfactomedin-2,Olfm2
EIAAB27474 Noe3,Noelin-3,Olfactomedin-3,Olfm3,Optimedin,Rat,Rattus norvegicus
EIAAB27475 Mouse,Mus musculus,Noe3,Noelin-3,Olfactomedin-3,Olfm3,Optimedin
EIAAB27472 Homo sapiens,Human,NOE2,Noelin-2,Olfactomedin-2,OLFM2
EIAAB27473 Homo sapiens,Human,NOE3,Noelin-3,Olfactomedin-3,OLFM3,Optimedin,UNQ1924_PRO4399
Olfm-101AP Noelin-1 Olfactomedin-1) antibodies Polyclonal anbtibody Host: Rabbit Affinity purifed 200ul
Olfm-101AP Noelin-1 Olfactomedin-1) antibodies WB control: PC-Olfm Host: Rabbit Affinity purifed 100-150ul
Olfm-101AP Noelin-1 Olfactomedin-1) antibodies Antigenic peptide: P-Olfm Host: Rabbit Affinity purifed 100ul
Olfm-101AP Noelin-1 Olfactomedin-1) antibodies FITC-conjugates: Olfm-FITC Host: Rabbit Affinity purifed 200ul
Olfm-101AP Noelin-1 Olfactomedin-1) antibodies Biotin Conjugates: Olfm-Biotin Host: Rabbit Affinity purifed 200ul
30-712 OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.This gene was originally cloned from human myeloblasts and found to be selectiv 0.1 mg
E0563p Rat ELISA Kit FOR Olfactomedin-like protein 3 96T
KS6A5_CHICK Rat ELISA Kit FOR Olfactomedin-like protein 3 96T
E6947h Human Olfactomedin Like Protein 2B ELISA Kit 96T
E7376h Human Olfactomedin Like Protein 2A ELISA Kit 96T
E6924h Human Olfactomedin Like Protein 1 ELISA Kit 96T
E0112h Bovine ELISA Kit FOR Olfactomedin-like protein 2B 96T
E0151h Bovine ELISA Kit FOR Olfactomedin-like protein 3 96T
ERD23_MOUSE Bovine ELISA Kit FOR Olfactomedin-like protein 2B 96T
UTP11_HUMAN Bovine ELISA Kit FOR Olfactomedin-like protein 2B 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP2199: Seed Development
WP2272: Pathogenic Escherichia coli infection
WP731: Sterol regulatory element binding protein related
WP1049: G Protein Signaling Pathways
WP1165: G Protein Signaling Pathways
WP1371: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1493: Carbon assimilation C4 pathway
WP1497: Hedgehog-related genes
WP1502: Mitochondrial biogenesis
WP1531: Vitamin D synthesis
WP1559: TFs Regulate miRNAs related to cardiac hypertrophy
WP1566: Citrate cycle (TCA cycle)
WP1613: 1,4-Dichlorobenzene degradation
WP1616: ABC transporters
WP1624: Bacterial secretion system
WP1625: Base excision repair
WP1644: DNA replication
WP1650: Fluorobenzoate degradation
WP1654: gamma-Hexachlorocyclohexane degradation
WP1657: Glycerolipid metabolism
WP1659: Glycine, serine and threonine metabolism
WP1661: Glyoxylate and dicarboxylate metabolism
WP1663: Homologous recombination
WP1665: Limonene and pinene degradation

Related Genes :
[Olfm1 Noe1 Noel Noel1] Noelin (Neuronal olfactomedin-related ER localized protein) (Olfactomedin-1) (Pancortin)
[Olfm1 D2Sut1e Noe1 Noel Noel1] Noelin (1B426B) (Neuronal olfactomedin-related ER localized protein) (Olfactomedin-1) (Pancortin)
[OLFM1 NOE1 NOEL1] Noelin (Neuronal olfactomedin-related ER localized protein) (Olfactomedin-1)
[OLFM3 NOE3 UNQ1924/PRO4399] Noelin-3 (Olfactomedin-3) (Optimedin)
[Olfm2] Noelin-2 (Olfactomedin-2)
[OLFM2 NOE2] Noelin-2 (Olfactomedin-2)
[Olfm2] Noelin-2 (Olfactomedin-2)
[Olfm3 Noe3] Noelin-3 (Olfactomedin-3) (Optimedin)
[Olfm3 Noe3] Noelin-3 (Olfactomedin-3) (Optimedin)
[OLFML3 PSEC0035 PSEC0173 PSEC0244 UNQ663/PRO1294] Olfactomedin-like protein 3 (HNOEL-iso) (hOLF44)
[ASIC2 ACCN ACCN1 BNAC1 MDEG] Acid-sensing ion channel 2 (ASIC2) (Amiloride-sensitive brain sodium channel) (Amiloride-sensitive cation channel 1, neuronal) (Amiloride-sensitive cation channel neuronal 1) (Brain sodium channel 1) (BNC1) (BNaC1) (Mammalian degenerin homolog) (MDEG)
[HEY1 BHLHB31 CHF2 HERP2 HESR1 HRT1] Hairy/enhancer-of-split related with YRPW motif protein 1 (Cardiovascular helix-loop-helix factor 2) (CHF-2) (Class B basic helix-loop-helix protein 31) (bHLHb31) (HES-related repressor protein 1) (Hairy and enhancer of split-related protein 1) (HESR-1) (Hairy-related transcription factor 1) (HRT-1) (hHRT1)
[] Olfactomedin (Olfactory mucus protein)
[Nrcam Kiaa0343] Neuronal cell adhesion molecule (Nr-CAM) (Neuronal surface protein Bravo) (mBravo) (NgCAM-related cell adhesion molecule) (Ng-CAM-related)
[Nptx1] Neuronal pentraxin-1 (NP1) (47 kDa taipoxin-binding protein) (Neuronal pentraxin I) (NP-I)
[ERECTA ER QRP1 QRS1 TE1 At2g26330 T1D16.3] LRR receptor-like serine/threonine-protein kinase ERECTA (EC 2.7.11.1) (Protein QUANTITATIVE RESISTANCE TO PLECTOSPHAERELLA 1) (Protein QUANTITATIVE RESISTANCE TO RALSTONIA SOLANACEARUM 1) (Protein TRANSPIRATION EFFICIENCY 1)
[MYOC GLC1A TIGR] Myocilin (Myocilin 55 kDa subunit) (Trabecular meshwork-induced glucocorticoid response protein) [Cleaved into: Myocilin, N-terminal fragment (Myocilin 20 kDa N-terminal fragment); Myocilin, C-terminal fragment (Myocilin 35 kDa N-terminal fragment)]
[DNAJB11 EDJ ERJ3 HDJ9 PSEC0121 UNQ537/PRO1080] DnaJ homolog subfamily B member 11 (APOBEC1-binding protein 2) (ABBP-2) (DnaJ protein homolog 9) (ER-associated DNAJ) (ER-associated Hsp40 co-chaperone) (Endoplasmic reticulum DNA J domain-containing protein 3) (ER-resident protein ERdj3) (ERdj3) (ERj3p) (HEDJ) (Human DnaJ protein 9) (hDj-9) (PWP1-interacting protein 4)
[GPER1 CEPR CMKRL2 DRY12 GPER GPR30] G-protein coupled estrogen receptor 1 (Chemoattractant receptor-like 2) (Flow-induced endothelial G-protein coupled receptor 1) (FEG-1) (G protein-coupled estrogen receptor 1) (G-protein coupled receptor 30) (GPCR-Br) (IL8-related receptor DRY12) (Lymphocyte-derived G-protein coupled receptor) (LYGPR) (Membrane estrogen receptor) (mER)
[1a] Replicase polyprotein 1a (pp1a) (ORF1a polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (Leader protein); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.69) (PL2-PRO) (Papain-like proteinase) (PL-PRO) (SARS coronavirus main proteinase); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (nsp5); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); Non-structural protein 11 (nsp11)]
[CLN5] Ceroid-lipofuscinosis neuronal protein 5 (Protein CLN5) [Cleaved into: Ceroid-lipofuscinosis neuronal protein 5, secreted form]
[NTRK1 MTC TRK TRKA] High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA)
[nsy-1 F59A6.1] Mitogen-activated protein kinase kinase kinase nsy-1 (EC 2.7.11.25) (Apoptosis signal-regulating kinase 1) (ASK-1) (Neuronal symmetry kinase 1)
[Nfe2l1 Nrf1] Endoplasmic reticulum membrane sensor NFE2L1 (Locus control region-factor 1) (LCR-F1) (Nuclear factor erythroid 2-related factor 1) (NF-E2-related factor 1) (NFE2-related factor 1) (Nuclear factor, erythroid derived 2, like 1) [Cleaved into: Transcription factor NRF1]
[KCNH2 ERG ERG1 HERG] Potassium voltage-gated channel subfamily H member 2 (Eag homolog) (Ether-a-go-go-related gene potassium channel 1) (ERG-1) (Eag-related protein 1) (Ether-a-go-go-related protein 1) (H-ERG) (hERG-1) (hERG1) (Voltage-gated potassium channel subunit Kv11.1)
[Npas2] Neuronal PAS domain-containing protein 2 (Neuronal PAS2)
[KIN10 AK21 AKIN10 SKIN10 SNR2 SNRK1.1 At3g01090 T4P13.22] SNF1-related protein kinase catalytic subunit alpha KIN10 (AKIN10) (EC 2.7.11.1) (AKIN alpha-2) (AKINalpha2) (SNF1-related kinase 1.1) (SnRK1.1)
[APP A4 AD1] Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31]
[KIN11 AKIN11 SNR1 SNRK1.2 At3g29160 MXE2.16] SNF1-related protein kinase catalytic subunit alpha KIN11 (AKIN11) (EC 2.7.11.1) (AKIN alpha-1) (AKINalpha1) (SNF1-related kinase 1.2) (SnRK1.2)
[Gldn Crgl2] Gliomedin (Cancer-related gene liver 2 protein) (CRG-L2) [Cleaved into: Gliomedin shedded ectodomain]

Bibliography :
No related Items