GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Non-receptor tyrosine-protein kinase TNK1 (EC 2.7.10.2) (Kinase of embryonic stem cells)

 TNK1_MOUSE              Reviewed;         666 AA.
Q99ML2; Q8CCC4; Q8K0X9; Q91V11;
15-FEB-2005, integrated into UniProtKB/Swiss-Prot.
15-FEB-2005, sequence version 2.
13-FEB-2019, entry version 137.
RecName: Full=Non-receptor tyrosine-protein kinase TNK1;
EC=2.7.10.2;
AltName: Full=Kinase of embryonic stem cells;
Name=Tnk1 {ECO:0000312|EMBL:AAK35164.1};
Synonyms=Kos1 {ECO:0000312|MGI:MGI:1930958};
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1] {ECO:0000305, ECO:0000312|EMBL:AAL09413.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 2), FUNCTION,
AUTOPHOSPHORYLATION, MUTAGENESIS OF LYS-148, SUBCELLULAR LOCATION, AND
TISSUE SPECIFICITY.
STRAIN=129/Sv {ECO:0000312|EMBL:AAL09412.1};
TISSUE=Embryonic stem cell;
PubMed=12789265; DOI=10.1038/sj.onc.1206480;
Hoare K., Hoare S., Smith O.M., Kalmaz G., Small D., May W.S. Jr.;
"Kos1, a nonreceptor tyrosine kinase that suppresses Ras signaling.";
Oncogene 22:3562-3577(2003).
[2] {ECO:0000305, ECO:0000312|EMBL:AAK35164.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Hoehn G.T., Felschow D.M., Civin C.I.;
"Cloning of the murine Tnk1 tyrosine kinase and evidence that it plays
a role in cell adhesion.";
Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases.
[3] {ECO:0000305, ECO:0000312|EMBL:AAH29623.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=FVB/N-3 {ECO:0000312|EMBL:AAH55303.1};
TISSUE=Mammary gland {ECO:0000312|EMBL:AAH29623.1};
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 151-666 (ISOFORM 1).
STRAIN=C57BL/6J; TISSUE=Colon;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[5]
FUNCTION, AND DISRUPTION PHENOTYPE.
PubMed=18974114; DOI=10.1158/0008-5472.CAN-08-1467;
Hoare S., Hoare K., Reinhard M.K., Lee Y.J., Oh S.P., May W.S. Jr.;
"Tnk1/Kos1 knockout mice develop spontaneous tumors.";
Cancer Res. 68:8723-8732(2008).
[6]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-498, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Kidney;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: May function in signaling pathways utilized broadly
during fetal development and more selectively in adult tissues and
in cells of the lymphohematopoietic system. Could specifically be
involved in phospholipid signal transduction (By similarity).
Involved in negative regulation of cell growth. Has tumor
suppressor properties. Plays a negative regulatory role in the
Ras-MAPK pathway. {ECO:0000250, ECO:0000269|PubMed:12789265,
ECO:0000269|PubMed:18974114}.
-!- CATALYTIC ACTIVITY:
Reaction=ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-
tyrosyl-[protein]; Xref=Rhea:RHEA:10596, Rhea:RHEA-COMP:10136,
Rhea:RHEA-COMP:10137, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616,
ChEBI:CHEBI:46858, ChEBI:CHEBI:82620, ChEBI:CHEBI:456216;
EC=2.7.10.2; Evidence={ECO:0000255|PROSITE-ProRule:PRU10028};
-!- SUBUNIT: Interacts with the SH3 domain of PLCG1 via its Pro-rich
domain. {ECO:0000250|UniProtKB:Q13470}.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000250}. Cytoplasm
{ECO:0000269|PubMed:12789265}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1 {ECO:0000269|Ref.2};
IsoId=Q99ML2-1; Sequence=Displayed;
Name=2 {ECO:0000269|PubMed:12789265};
IsoId=Q99ML2-2; Sequence=VSP_051664, VSP_051665;
-!- TISSUE SPECIFICITY: Expressed in whole embryo and all adult
tissues examined including liver, kidney, heart, brain, skeletal
muscle and intestine. Also detected in various myeloid- and
lymphoid-derived cell lines. {ECO:0000269|PubMed:12789265}.
-!- DEVELOPMENTAL STAGE: Expression during embryogenesis increases
between 7 dpc and 11 dpc. Levels of expression subsequently
decrease and reach a steady-state level by 17 dpc.
{ECO:0000269|PubMed:12789265}.
-!- PTM: Autophosphorylated on tyrosine residues.
{ECO:0000269|PubMed:12789265}.
-!- DISRUPTION PHENOTYPE: Mice develop spontaneous tumors, including
lymphomas and carcinomas at high rates.
{ECO:0000269|PubMed:18974114}.
-!- SIMILARITY: Belongs to the protein kinase superfamily. Tyr protein
kinase family. {ECO:0000255|PROSITE-ProRule:PRU00159}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF307745; AAL09412.1; -; Genomic_DNA.
EMBL; AF307746; AAL09413.1; -; mRNA.
EMBL; AF332512; AAK35164.1; -; mRNA.
EMBL; BC029623; AAH29623.1; -; mRNA.
EMBL; BC055303; AAH55303.1; -; mRNA.
EMBL; AK033440; BAC28288.1; -; mRNA.
CCDS; CCDS24917.1; -. [Q99ML2-1]
RefSeq; NP_114086.3; NM_031880.3. [Q99ML2-1]
RefSeq; XP_006534617.1; XM_006534554.3. [Q99ML2-1]
UniGene; Mm.28874; -.
UniGene; Mm.358793; -.
ProteinModelPortal; Q99ML2; -.
SMR; Q99ML2; -.
STRING; 10090.ENSMUSP00000001626; -.
iPTMnet; Q99ML2; -.
PhosphoSitePlus; Q99ML2; -.
PaxDb; Q99ML2; -.
PRIDE; Q99ML2; -.
Ensembl; ENSMUST00000001626; ENSMUSP00000001626; ENSMUSG00000001583. [Q99ML2-1]
Ensembl; ENSMUST00000108626; ENSMUSP00000104266; ENSMUSG00000001583. [Q99ML2-2]
GeneID; 83813; -.
KEGG; mmu:83813; -.
UCSC; uc007jsb.2; mouse. [Q99ML2-1]
UCSC; uc007jsc.2; mouse. [Q99ML2-2]
CTD; 8711; -.
MGI; MGI:1930958; Tnk1.
eggNOG; KOG0199; Eukaryota.
eggNOG; ENOG410XPRC; LUCA.
GeneTree; ENSGT00940000162159; -.
HOGENOM; HOG000231055; -.
HOVERGEN; HBG055513; -.
InParanoid; Q99ML2; -.
KO; K08885; -.
OMA; MGEDYYR; -.
OrthoDB; 1008736at2759; -.
TreeFam; TF316643; -.
PRO; PR:Q99ML2; -.
Proteomes; UP000000589; Chromosome 11.
Bgee; ENSMUSG00000001583; Expressed in 121 organ(s), highest expression level in cochlea.
ExpressionAtlas; Q99ML2; baseline and differential.
Genevisible; Q99ML2; MM.
GO; GO:0005737; C:cytoplasm; ISO:MGI.
GO; GO:0005829; C:cytosol; IDA:UniProtKB.
GO; GO:0016020; C:membrane; ISO:MGI.
GO; GO:0005524; F:ATP binding; IMP:UniProtKB.
GO; GO:0004715; F:non-membrane spanning protein tyrosine kinase activity; IDA:UniProtKB.
GO; GO:0004713; F:protein tyrosine kinase activity; ISO:MGI.
GO; GO:0030154; P:cell differentiation; IBA:GO_Central.
GO; GO:0030308; P:negative regulation of cell growth; IMP:UniProtKB.
GO; GO:0046580; P:negative regulation of Ras protein signal transduction; IMP:UniProtKB.
GO; GO:0038083; P:peptidyl-tyrosine autophosphorylation; IBA:GO_Central.
GO; GO:0046777; P:protein autophosphorylation; IDA:UniProtKB.
GO; GO:0042127; P:regulation of cell population proliferation; IBA:GO_Central.
InterPro; IPR011009; Kinase-like_dom_sf.
InterPro; IPR000719; Prot_kinase_dom.
InterPro; IPR017441; Protein_kinase_ATP_BS.
InterPro; IPR001245; Ser-Thr/Tyr_kinase_cat_dom.
InterPro; IPR036028; SH3-like_dom_sf.
InterPro; IPR001452; SH3_domain.
InterPro; IPR008266; Tyr_kinase_AS.
InterPro; IPR020635; Tyr_kinase_cat_dom.
Pfam; PF07714; Pkinase_Tyr; 1.
PRINTS; PR00109; TYRKINASE.
SMART; SM00219; TyrKc; 1.
SUPFAM; SSF50044; SSF50044; 1.
SUPFAM; SSF56112; SSF56112; 1.
PROSITE; PS00107; PROTEIN_KINASE_ATP; 1.
PROSITE; PS50011; PROTEIN_KINASE_DOM; 1.
PROSITE; PS00109; PROTEIN_KINASE_TYR; 1.
PROSITE; PS50002; SH3; 1.
1: Evidence at protein level;
Alternative splicing; ATP-binding; Complete proteome; Cytoplasm;
Kinase; Membrane; Nucleotide-binding; Phosphoprotein;
Reference proteome; SH3 domain; Transferase; Tyrosine-protein kinase.
CHAIN 1 666 Non-receptor tyrosine-protein kinase
TNK1.
/FTId=PRO_0000088174.
DOMAIN 116 383 Protein kinase. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
DOMAIN 381 441 SH3. {ECO:0000255|PROSITE-
ProRule:PRU00192}.
NP_BIND 122 130 ATP. {ECO:0000250|UniProtKB:P12931,
ECO:0000255|PROSITE-ProRule:PRU00159}.
COMPBIAS 507 560 Pro-rich.
ACT_SITE 245 245 Proton acceptor.
{ECO:0000250|UniProtKB:P12931,
ECO:0000255|PROSITE-ProRule:PRU00159,
ECO:0000255|PROSITE-ProRule:PRU10028}.
BINDING 148 148 ATP. {ECO:0000250|UniProtKB:P12931,
ECO:0000255|PROSITE-ProRule:PRU00159}.
MOD_RES 96 96 Phosphoserine.
{ECO:0000250|UniProtKB:Q13470}.
MOD_RES 255 255 Phosphoserine.
{ECO:0000250|UniProtKB:Q13470}.
MOD_RES 498 498 Phosphoserine.
{ECO:0000244|PubMed:21183079}.
MOD_RES 510 510 Phosphothreonine.
{ECO:0000250|UniProtKB:Q13470}.
MOD_RES 515 515 Phosphoserine.
{ECO:0000250|UniProtKB:Q13470}.
MOD_RES 582 582 Phosphoserine.
{ECO:0000250|UniProtKB:Q13470}.
VAR_SEQ 381 434 AWLSEGRCVREVTEPGALRMEPGDPITIIEGSLDTATWKGQ
NGRTLKVGNFPAS -> VRIPNSPYTHIAFLPCILSPSVPC
RRQTRLGAWAGIWNSAQNQVQSLPAGSAEP (in
isoform 2).
{ECO:0000303|PubMed:12789265}.
/FTId=VSP_051664.
VAR_SEQ 435 666 Missing (in isoform 2).
{ECO:0000303|PubMed:12789265}.
/FTId=VSP_051665.
MUTAGEN 148 148 K->A: Loss of autophosphorylation.
{ECO:0000269|PubMed:12789265}.
CONFLICT 46 46 L -> V (in Ref. 2; AAK35164).
{ECO:0000305}.
CONFLICT 59 59 L -> I (in Ref. 2; AAK35164).
{ECO:0000305}.
CONFLICT 206 206 A -> T (in Ref. 3; AAH29623/AAH55303).
{ECO:0000305}.
CONFLICT 534 534 P -> S (in Ref. 2; AAK35164).
{ECO:0000305}.
SEQUENCE 666 AA; 73099 MW; 5AE6A48D99BADE8B CRC64;
MLPEASSLWL LRLLRDVQLA QFYRPILEEL NVTRPEHFDF VRPEDLDNIG MGRPAQRRLN
EALKRYRSGV KSKNWVYKIL GGFAPEQKEI PPRSDSPLCF HEPEGGLKCL IPEGAVRRGE
LLGSGCFGVV HRGLWTLPSG QSIPVAVKSL RVGPEGPMGT ELGDFLREVS VMMKLEHPHV
LRLHGLVLGQ PLQMVMELAP LGSLHARLTA PAPTPPLPVA LLCLFLRQLA GAMAYLGSCG
LVHRDLATRN LLLASPRMIK VADFGLVRPL GGARGRYVMG GPRPIPYAWC APESLRQGAF
SSASDVWMFG VTLWEMFSGG EEPWAGVPPY LILQRLEKDR ARLPKPPLCS RALYSLALRC
WAPHPADRPS FSNLEGLLQE AWLSEGRCVR EVTEPGALRM EPGDPITIIE GSLDTATWKG
QNGRTLKVGN FPASAVTLAD LGGSPVTHPA HRGSPAHGEK CRGGTDGDRE KATLQDLPPA
RSHRTKMPLQ RMRGISKSLE SVLSLGPRPT GGGSSPPELR RTRAMPQRLP DLPPRPPDLP
PRPPIICNSS QPTQPHKARP KRESSHNHRT GAPGASKATV PSGGPLSDPE WQRKVVEVEL
SVHGVTYQEC QVALRTTGGD VASAIRNLKV DQLFHLSNRS RADCRRILEH HQWDLSAASR
YILARS


Related products :

Catalog number Product name Quantity
EIAAB43303 Kinase of embryonic stem cells,Kos1,Mouse,Mus musculus,Non-receptor tyrosine-protein kinase TNK1,Tnk1
18-001-30079 Non-receptor tyrosine-protein kinase TNK1 - EC 2.7.10.2; Kinase of embryonic stem cells Polyclonal 0.1 mg
EIAAB13073 Embryonic stem cell kinase,Epha1,Ephrin type-A receptor 1,Esk,mEpha1,Mouse,Mus musculus,Tyrosine-protein kinase receptor ESK
EIAAB43304 CD38 negative kinase 1,Homo sapiens,Human,Non-receptor tyrosine-protein kinase TNK1,TNK1
E0147m ELISA Embryonic receptor kinase 2,Emrk2,Flt,Flt1,FLT-1,Fms-like tyrosine kinase 1,Mouse,Mus musculus,Tyrosine-protein kinase receptor FLT,Vascular endothelial growth factor receptor 1,VEGFR-1 96T
U0147m CLIA Embryonic receptor kinase 2,Emrk2,Flt,Flt1,FLT-1,Fms-like tyrosine kinase 1,Mouse,Mus musculus,Tyrosine-protein kinase receptor FLT,Vascular endothelial growth factor receptor 1,VEGFR-1 96T
E0147m ELISA kit Embryonic receptor kinase 2,Emrk2,Flt,Flt1,FLT-1,Fms-like tyrosine kinase 1,Mouse,Mus musculus,Tyrosine-protein kinase receptor FLT,Vascular endothelial growth factor receptor 1,VEGFR-1 96T
E0039h ELISA kit CD135,Fetal liver kinase-2,FL cytokine receptor,FLK2,FLK-2,FLT3,FLT-3,Fms-like tyrosine kinase 3,Homo sapiens,Human,Receptor-type tyrosine-protein kinase FLT3,Stem cell tyrosine kinase 1,ST 96T
U0039h CLIA CD135,Fetal liver kinase-2,FL cytokine receptor,FLK2,FLK-2,FLT3,FLT-3,Fms-like tyrosine kinase 3,Homo sapiens,Human,Receptor-type tyrosine-protein kinase FLT3,Stem cell tyrosine kinase 1,STK1,STK 96T
E0039h ELISA CD135,Fetal liver kinase-2,FL cytokine receptor,FLK2,FLK-2,FLT3,FLT-3,Fms-like tyrosine kinase 3,Homo sapiens,Human,Receptor-type tyrosine-protein kinase FLT3,Stem cell tyrosine kinase 1,STK1,ST 96T
EIAAB13106 EK2,Embryonic kinase 2,EPHB3,EPH-like kinase 2,EPH-like tyrosine kinase 2,Ephrin type-B receptor 3,ETK2,hEK2,HEK2,Homo sapiens,Human,TYRO6,Tyrosine-protein kinase TYRO6
CSB-EL024002MO Mouse Non-receptor tyrosine-protein kinase TNK1(TNK1) ELISA kit 96T
CSB-EL024002HU Human Non-receptor tyrosine-protein kinase TNK1(TNK1) ELISA kit 96T
CSB-EL024002MO Mouse Non-receptor tyrosine-protein kinase TNK1(TNK1) ELISA kit SpeciesMouse 96T
CSB-EL024002HU Human Non-receptor tyrosine-protein kinase TNK1(TNK1) ELISA kit SpeciesHuman 96T
TNK1_MOUSE ELISA Kit FOR Non-receptor tyrosine-protein kinase TNK1; organism: Mouse; gene name: Tnk1 96T
EIAAB33008 CCK4,CCK-4,Colon carcinoma kinase 4,Homo sapiens,Human,Inactive tyrosine-protein kinase 7,Protein-tyrosine kinase 7,Pseudo tyrosine kinase receptor 7,PTK7,Tyrosine-protein kinase-like 7
EIAAB13074 Eck,Epha2,Ephrin type-A receptor 2,Epithelial cell kinase,Mouse,Mus musculus,Myk2,Sek2,Tyrosine-protein kinase receptor ECK,Tyrosine-protein kinase receptor MPK-5,Tyrosine-protein kinase receptor SEK-
EIAAB13105 Ephb2,Ephrin type-B receptor 2,Epth3,Mouse,Mus musculus,Neural kinase,Nuk,Nuk receptor tyrosine kinase,Sek3,Tyrosine-protein kinase receptor EPH-3,Tyrosine-protein kinase receptor SEK-3
EIAAB33010 Inactive tyrosine-protein kinase 7,Mouse,Mus musculus,Protein chuzhoi,Protein-tyrosine kinase 7,Pseudo tyrosine kinase receptor 7,Ptk7,Tyrosine-protein kinase-like 7
EIAAB13072 EPH,EPH tyrosine kinase,EPH tyrosine kinase 1,EPHA1,Ephrin type-A receptor 1,EPHT,EPHT1,Erythropoietin-producing hepatoma receptor,hEpha1,Homo sapiens,Human,Tyrosine-protein kinase receptor EPH
TNK1 TNK1 Gene tyrosine kinase, non-receptor, 1
E0039m ELISA Fetal liver kinase 2,FL cytokine receptor,FLK-2,Flk-2,Flt3,FLT-3,Flt-3,Fms-like tyrosine kinase 3,Mouse,Mus musculus,Receptor-type tyrosine-protein kinase FLT3,Tyrosine-protein kinase receptor f 96T
U0039m CLIA Fetal liver kinase 2,FL cytokine receptor,FLK-2,Flk-2,Flt3,FLT-3,Flt-3,Fms-like tyrosine kinase 3,Mouse,Mus musculus,Receptor-type tyrosine-protein kinase FLT3,Tyrosine-protein kinase receptor fl 96T
E0039m ELISA kit Fetal liver kinase 2,FL cytokine receptor,FLK-2,Flk-2,Flt3,FLT-3,Flt-3,Fms-like tyrosine kinase 3,Mouse,Mus musculus,Receptor-type tyrosine-protein kinase FLT3,Tyrosine-protein kinase recep 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1493: Carbon assimilation C4 pathway
WP1567: Glycolysis and Gluconeogenesis
WP1619: Amino sugar and nucleotide sugar metabolism
WP1653: Galactose metabolism
WP1681: Pantothenate and CoA biosynthesis
WP1701: Starch and sucrose metabolism
WP1703: Streptomycin biosynthesis
WP1714: Tyrosine metabolism
WP1844: MAP kinase cascade
WP1946: Cori Cycle
WP2272: Pathogenic Escherichia coli infection
WP2292: Chemokine signaling pathway
WP2340: Thiamine (vitamin B1) biosynthesis and salvage
WP2341: vitamin B1 (thiamin) biosynthesis and salvage pathway
WP253: Glycolysis
WP32: Translation Factors
WP1004: Kit Receptor Signaling Pathway
WP1011: T Cell Receptor Signaling Pathway
WP1014: Androgen receptor signaling pathway
WP1025: B Cell Receptor Signaling Pathway
WP1045: TGF-beta Receptor Signaling Pathway
WP1046: Signaling of Hepatocyte Growth Factor Receptor
WP1049: G Protein Signaling Pathways
WP1067: Toll-like receptor signaling pathway
WP1112: EPO Receptor Signaling

Related Genes :
[TNK1] Non-receptor tyrosine-protein kinase TNK1 (EC 2.7.10.2) (CD38 negative kinase 1)
[Flt1 Emrk2 Flt Vegfr1] Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Embryonic receptor kinase 2) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase receptor FLT)
[FLT3 CD135 FLK2 STK1] Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase-2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Stem cell tyrosine kinase 1) (STK-1) (CD antigen CD135)
[Tek Hyk Tie-2 Tie2] Angiopoietin-1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (HYK) (STK1) (Tunica interna endothelial cell kinase) (Tyrosine kinase with Ig and EGF homology domains-2) (Tyrosine-protein kinase receptor TEK) (Tyrosine-protein kinase receptor TIE-2) (mTIE2) (p140 TEK) (CD antigen CD202b)
[KIT SCFR] Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Piebald trait protein) (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD antigen CD117)
[Epha2 Eck Myk2 Sek2] Ephrin type-A receptor 2 (EC 2.7.10.1) (Epithelial cell kinase) (Tyrosine-protein kinase receptor ECK) (Tyrosine-protein kinase receptor MPK-5) (Tyrosine-protein kinase receptor SEK-2)
[MELK KIAA0175] Maternal embryonic leucine zipper kinase (hMELK) (EC 2.7.11.1) (Protein kinase Eg3) (pEg3 kinase) (Protein kinase PK38) (hPK38) (Tyrosine-protein kinase MELK) (EC 2.7.10.2)
[Tnk2 Ack1] Activated CDC42 kinase 1 (ACK-1) (EC 2.7.10.2) (EC 2.7.11.1) (Non-receptor protein tyrosine kinase Ack) (Tyrosine kinase non-receptor protein 2)
[PTK2B FAK2 PYK2 RAFTK] Protein-tyrosine kinase 2-beta (EC 2.7.10.2) (Calcium-dependent tyrosine kinase) (CADTK) (Calcium-regulated non-receptor proline-rich tyrosine kinase) (Cell adhesion kinase beta) (CAK-beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine kinase 2) (Related adhesion focal tyrosine kinase) (RAFTK)
[Flt3 Flk-2 Flt-3] Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase 2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Tyrosine-protein kinase receptor flk-2) (CD antigen CD135)
[Ptk2b Fak2 Pyk2 Raftk] Protein-tyrosine kinase 2-beta (EC 2.7.10.2) (Calcium-dependent tyrosine kinase) (CADTK) (Calcium-regulated non-receptor proline-rich tyrosine kinase) (Cell adhesion kinase beta) (CAK-beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine kinase 2) (Related adhesion focal tyrosine kinase) (RAFTK)
[Melk Kiaa0175 Pk38] Maternal embryonic leucine zipper kinase (EC 2.7.11.1) (Protein kinase PK38) (mPK38) (Tyrosine-protein kinase MELK) (EC 2.7.10.2)
[KDR FLK1 VEGFR2] Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase insert domain receptor) (KDR) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309)
[FLT1 FLT FRT VEGFR1] Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor)
[Ptk2b Fak2 Pyk2] Protein-tyrosine kinase 2-beta (EC 2.7.10.2) (Calcium-dependent tyrosine kinase) (CADTK) (Calcium-regulated non-receptor proline-rich tyrosine kinase) (Cell adhesion kinase beta) (CAK-beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine kinase 2)
[Kit Sl] Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (CD antigen CD117)
[DDR1 CAK EDDR1 NEP NTRK4 PTK3A RTK6 TRKE] Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protein-tyrosine kinase 3A) (Protein-tyrosine kinase RTK-6) (TRK E) (Tyrosine kinase DDR) (Tyrosine-protein kinase CAK) (CD antigen CD167a)
[NTRK1 MTC TRK TRKA] High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA)
[FGFR1 BFGFR CEK FGFBR FLG FLT2 HBGFR] Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)
[Kdr Flk-1 Flk1] Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase NYK) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309)
[ERBB2 HER2 MLN19 NEU NGL] Receptor tyrosine-protein kinase erbB-2 (EC 2.7.10.1) (Metastatic lymph node gene 19 protein) (MLN 19) (Proto-oncogene Neu) (Proto-oncogene c-ErbB-2) (Tyrosine kinase-type cell surface receptor HER2) (p185erbB2) (CD antigen CD340)
[EPHB1 ELK EPHT2 HEK6 NET] Ephrin type-B receptor 1 (EC 2.7.10.1) (ELK) (EPH tyrosine kinase 2) (EPH-like kinase 6) (EK6) (hEK6) (Neuronally-expressed EPH-related tyrosine kinase) (NET) (Tyrosine-protein kinase receptor EPH-2)
[Ephb2 Epth3 Nuk Sek3] Ephrin type-B receptor 2 (EC 2.7.10.1) (Neural kinase) (Nuk receptor tyrosine kinase) (Tyrosine-protein kinase receptor EPH-3) (Tyrosine-protein kinase receptor SEK-3) [Cleaved into: EphB2/CTF1; EphB2/CTF2]
[Eif2ak2 Pkr Prkr Tik] Interferon-induced, double-stranded RNA-activated protein kinase (EC 2.7.11.1) (Eukaryotic translation initiation factor 2-alpha kinase 2) (eIF-2A protein kinase 2) (Interferon-inducible RNA-dependent protein kinase) (P1/eIF-2A protein kinase) (Protein kinase RNA-activated) (PKR) (Protein kinase R) (Serine/threonine-protein kinase TIK) (Tyrosine-protein kinase EIF2AK2) (EC 2.7.10.2) (p68 kinase)
[TEK TIE2 VMCM VMCM1] Angiopoietin-1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (Tunica interna endothelial cell kinase) (Tyrosine kinase with Ig and EGF homology domains-2) (Tyrosine-protein kinase receptor TEK) (Tyrosine-protein kinase receptor TIE-2) (hTIE2) (p140 TEK) (CD antigen CD202b)
[ERBB4 HER4] Receptor tyrosine-protein kinase erbB-4 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-4) (Tyrosine kinase-type cell surface receptor HER4) (p180erbB4) [Cleaved into: ERBB4 intracellular domain (4ICD) (E4ICD) (s80HER4)]
[Epha7 Ebk Ehk3 Mdk1] Ephrin type-A receptor 7 (EC 2.7.10.1) (Developmental kinase 1) (mDK-1) (EPH homology kinase 3) (EHK-3) (Embryonic brain kinase) (EBK)
[Epha4 Sek Sek1] Ephrin type-A receptor 4 (EC 2.7.10.1) (Tyrosine-protein kinase receptor MPK-3) (Tyrosine-protein kinase receptor SEK-1)
[TEK TIE-2 TIE2] Angiopoietin-1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (Tyrosine kinase with Ig and EGF homology domains-2) (Tyrosine-protein kinase receptor TIE-2) (CD antigen CD202b)
[kita kit sparse] Mast/stem cell growth factor receptor kita (SCFR) (EC 2.7.10.1) (Tyrosine-protein kinase Kit)

Bibliography :