GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

PDZ domain-containing protein 11 (ATPase-interacting PDZ protein) (Plasma membrane calcium ATPase-interacting single-PDZ protein) (PMCA-interacting single-PDZ protein)

 PDZ11_HUMAN             Reviewed;         140 AA.
Q5EBL8; D3DVU3; Q6UWE1; Q9P0Q1;
16-AUG-2005, integrated into UniProtKB/Swiss-Prot.
16-AUG-2005, sequence version 2.
07-APR-2021, entry version 148.
RecName: Full=PDZ domain-containing protein 11;
AltName: Full=ATPase-interacting PDZ protein;
AltName: Full=Plasma membrane calcium ATPase-interacting single-PDZ protein;
Short=PMCA-interacting single-PDZ protein;
Name=PDZD11; Synonyms=AIPP1, PDZK11, PISP;
ORFNames=HSPC227, UNQ6486/PRO21335;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Umbilical cord blood;
PubMed=11042152; DOI=10.1101/gr.140200;
Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G.,
Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W.,
Tao J., Huang Q.-H., Zhou J., Hu G.-X., Gu J., Chen S.-J., Chen Z.;
"Cloning and functional analysis of cDNAs with open reading frames for 300
previously undefined genes expressed in CD34+ hematopoietic stem/progenitor
cells.";
Genome Res. 10:1546-1560(2000).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A.,
Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D.,
Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L.,
Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C.,
Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J.,
Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale effort to
identify novel human secreted and transmembrane proteins: a bioinformatics
assessment.";
Genome Res. 13:2265-2270(2003).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
TISSUE=Artery smooth muscle;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
"Cloning of human full open reading frames in Gateway(TM) system entry
vector (pDONR201).";
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Cerebellum;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D.,
Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A.,
Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15772651; DOI=10.1038/nature03440;
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D.,
Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L.,
Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.,
Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A.,
Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P.,
Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D.,
Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D.,
Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L.,
Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P.,
Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G.,
Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J.,
Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D.,
Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L.,
Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z.,
Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S.,
Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O.,
Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H.,
Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T.,
Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L.,
Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R.,
Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y.,
Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K.,
Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J.,
Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L.,
Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S.,
Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A.,
Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L.,
Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D.,
Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H.,
McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S.,
Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C.,
Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S.,
Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V.,
Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K.,
Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K.,
Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D.,
Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R.,
Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B.,
Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C.,
d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q.,
Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N.,
Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A.,
Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J.,
Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A.,
Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F.,
Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L.,
Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S.,
Rogers J., Bentley D.R.;
"The DNA sequence of the human X chromosome.";
Nature 434:325-337(2005).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Chondrosarcoma, and Muscle;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
INTERACTION WITH ATP2B1; ATP2B2; ATP2B3 AND ATP2B4, SUBCELLULAR LOCATION,
AND TISSUE SPECIFICITY.
PubMed=12763866; DOI=10.1111/j.1749-6632.2003.tb07230.x;
Goellner G.M., DeMarco S.J., Strehler E.E.;
"Characterization of PISP, a novel single-PDZ protein that binds to all
plasma membrane Ca2+-ATPase b-splice variants.";
Ann. N. Y. Acad. Sci. 986:461-471(2003).
[10]
INTERACTION WITH ATP7A, AND IDENTIFICATION OF ALTERNATIVE SPLICING
(ISOFORMS 1 AND 2).
PubMed=16051599; DOI=10.1074/jbc.m505889200;
Stephenson S.E., Dubach D., Lim C.M., Mercer J.F., La Fontaine S.;
"A single PDZ domain protein interacts with the Menkes copper ATPase,
ATP7A. A new protein implicated in copper homeostasis.";
J. Biol. Chem. 280:33270-33279(2005).
[11]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T.,
Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[12]
FUNCTION, INTERACTION WITH PLEKHA7, AND SUBCELLULAR LOCATION.
PubMed=30463011; DOI=10.1016/j.celrep.2018.10.088;
Shah J., Rouaud F., Guerrera D., Vasileva E., Popov L.M., Kelley W.L.,
Rubinstein E., Carette J.E., Amieva M.R., Citi S.;
"A Dock-and-Lock Mechanism Clusters ADAM10 at Cell-Cell Junctions to
Promote alpha-Toxin Cytotoxicity.";
Cell Rep. 25:2132-2147(2018).
[13]
VARIANT TYR-81.
PubMed=23033978; DOI=10.1056/nejmoa1206524;
de Ligt J., Willemsen M.H., van Bon B.W., Kleefstra T., Yntema H.G.,
Kroes T., Vulto-van Silfhout A.T., Koolen D.A., de Vries P., Gilissen C.,
del Rosario M., Hoischen A., Scheffer H., de Vries B.B., Brunner H.G.,
Veltman J.A., Vissers L.E.;
"Diagnostic exome sequencing in persons with severe intellectual
disability.";
N. Engl. J. Med. 367:1921-1929(2012).
-!- FUNCTION: Mediates docking of ADAM10 to zonula adherens by interacting
with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10-
binding protein TSPAN33. {ECO:0000269|PubMed:30463011}.
-!- SUBUNIT: Interacts with ATP2B1, ATP2B2, ATP2B3, ATP2B4 and ATP7A
(PubMed:12763866, PubMed:16051599). Interacts with PLEKHA7 (via WW
domains) at zonula adherens; this interaction is essential for the
interaction between PLEKHA7 and the ADAM10-binding protein TSPAN33
(PubMed:30463011). {ECO:0000269|PubMed:12763866,
ECO:0000269|PubMed:16051599, ECO:0000269|PubMed:30463011}.
-!- INTERACTION:
Q5EBL8; Q04656: ATP7A; NbExp=4; IntAct=EBI-1644207, EBI-7706409;
Q5EBL8; Q86UL8-2: MAGI2; NbExp=3; IntAct=EBI-1644207, EBI-12081182;
Q5EBL8; Q9HAU0: PLEKHA5; NbExp=11; IntAct=EBI-1644207, EBI-945934;
-!- SUBCELLULAR LOCATION: [Isoform 2]: Secreted {ECO:0000305}.
-!- SUBCELLULAR LOCATION: [Isoform 1]: Cytoplasm
{ECO:0000269|PubMed:12763866}. Cell junction, adherens junction
{ECO:0000269|PubMed:30463011}. Cell membrane
{ECO:0000269|PubMed:30463011}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1; Synonyms=AIPP1a;
IsoId=Q5EBL8-1; Sequence=Displayed;
Name=2; Synonyms=AIPP1b;
IsoId=Q5EBL8-2; Sequence=VSP_015077;
-!- TISSUE SPECIFICITY: Widely expressed (at protein level).
{ECO:0000269|PubMed:12763866}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AF151061; AAF36147.1; -; mRNA.
EMBL; AY358829; AAQ89188.1; -; mRNA.
EMBL; AK024746; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; CR457149; CAG33430.1; -; mRNA.
EMBL; BX537725; CAD97820.1; -; mRNA.
EMBL; AL357752; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471132; EAX05345.1; -; Genomic_DNA.
EMBL; CH471132; EAX05346.1; -; Genomic_DNA.
EMBL; BC012996; AAH12996.1; -; mRNA.
EMBL; BC089433; AAH89433.1; -; mRNA.
CCDS; CCDS14400.1; -. [Q5EBL8-1]
RefSeq; NP_057568.1; NM_016484.4. [Q5EBL8-1]
RefSeq; XP_011529275.1; XM_011530973.2.
RefSeq; XP_016885057.1; XM_017029568.1.
SMR; Q5EBL8; -.
BioGRID; 119405; 28.
CORUM; Q5EBL8; -.
IntAct; Q5EBL8; 22.
MINT; Q5EBL8; -.
STRING; 9606.ENSP00000239666; -.
iPTMnet; Q5EBL8; -.
PhosphoSitePlus; Q5EBL8; -.
BioMuta; PDZD11; -.
DMDM; 73621365; -.
EPD; Q5EBL8; -.
jPOST; Q5EBL8; -.
MassIVE; Q5EBL8; -.
MaxQB; Q5EBL8; -.
PaxDb; Q5EBL8; -.
PeptideAtlas; Q5EBL8; -.
PRIDE; Q5EBL8; -.
ProteomicsDB; 62764; -. [Q5EBL8-1]
ProteomicsDB; 62765; -. [Q5EBL8-2]
Antibodypedia; 581; 72 antibodies.
DNASU; 51248; -.
Ensembl; ENST00000239666; ENSP00000239666; ENSG00000120509. [Q5EBL8-1]
Ensembl; ENST00000374454; ENSP00000363578; ENSG00000120509. [Q5EBL8-1]
GeneID; 51248; -.
KEGG; hsa:51248; -.
UCSC; uc004dyd.2; human. [Q5EBL8-1]
CTD; 51248; -.
GeneCards; PDZD11; -.
HGNC; HGNC:28034; PDZD11.
HPA; ENSG00000120509; Low tissue specificity.
MIM; 300632; gene.
neXtProt; NX_Q5EBL8; -.
OpenTargets; ENSG00000120509; -.
PharmGKB; PA134968632; -.
VEuPathDB; HostDB:ENSG00000120509.10; -.
eggNOG; KOG3528; Eukaryota.
GeneTree; ENSGT00940000153222; -.
HOGENOM; CLU_133335_0_0_1; -.
InParanoid; Q5EBL8; -.
OMA; AWIPPQD; -.
OrthoDB; 1530562at2759; -.
PhylomeDB; Q5EBL8; -.
TreeFam; TF318964; -.
PathwayCommons; Q5EBL8; -.
Reactome; R-HSA-196780; Biotin transport and metabolism.
Reactome; R-HSA-199220; Vitamin B5 (pantothenate) metabolism.
Reactome; R-HSA-425397; Transport of vitamins, nucleosides, and related molecules.
Reactome; R-HSA-6803544; Ion influx/efflux at host-pathogen interface.
Reactome; R-HSA-936837; Ion transport by P-type ATPases.
SIGNOR; Q5EBL8; -.
BioGRID-ORCS; 51248; 12 hits in 632 CRISPR screens.
ChiTaRS; PDZD11; human.
GeneWiki; PDZD11; -.
GenomeRNAi; 51248; -.
Pharos; Q5EBL8; Tbio.
PRO; PR:Q5EBL8; -.
Proteomes; UP000005640; Chromosome X.
RNAct; Q5EBL8; protein.
Bgee; ENSG00000120509; Expressed in substantia nigra and 213 other tissues.
Genevisible; Q5EBL8; HS.
GO; GO:0005912; C:adherens junction; IEA:UniProtKB-SubCell.
GO; GO:0016323; C:basolateral plasma membrane; IDA:UniProtKB.
GO; GO:0005911; C:cell-cell junction; IBA:GO_Central.
GO; GO:0005829; C:cytosol; IDA:UniProtKB.
GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
GO; GO:0046930; C:pore complex; IMP:UniProtKB.
GO; GO:0098793; C:presynapse; IEA:GOC.
GO; GO:0045202; C:synapse; IBA:GO_Central.
GO; GO:0008022; F:protein C-terminus binding; IPI:UniProtKB.
GO; GO:0019730; P:antimicrobial humoral response; TAS:Reactome.
GO; GO:0006768; P:biotin metabolic process; TAS:Reactome.
GO; GO:0034220; P:ion transmembrane transport; TAS:Reactome.
GO; GO:0045199; P:maintenance of epithelial cell apical/basal polarity; IBA:GO_Central.
GO; GO:0007269; P:neurotransmitter secretion; IBA:GO_Central.
GO; GO:0015939; P:pantothenate metabolic process; TAS:Reactome.
GO; GO:0046931; P:pore complex assembly; IMP:UniProtKB.
GO; GO:1903361; P:protein localization to basolateral plasma membrane; IBA:GO_Central.
GO; GO:0055085; P:transmembrane transport; TAS:Reactome.
Gene3D; 2.30.42.10; -; 1.
InterPro; IPR001478; PDZ.
InterPro; IPR036034; PDZ_sf.
Pfam; PF00595; PDZ; 1.
SMART; SM00228; PDZ; 1.
SUPFAM; SSF50156; SSF50156; 1.
PROSITE; PS50106; PDZ; 1.
1: Evidence at protein level;
Alternative splicing; Cell junction; Cell membrane; Cytoplasm; Membrane;
Reference proteome; Secreted.
CHAIN 1..140
/note="PDZ domain-containing protein 11"
/id="PRO_0000058273"
DOMAIN 47..129
/note="PDZ"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"
VAR_SEQ 1
/note="M -> MGWSCCLKLAGLLSLLNHFLSVLIHSSRALPE (in isoform
2)"
/evidence="ECO:0000303|PubMed:12975309"
/id="VSP_015077"
VARIANT 81
/note="S -> Y (in dbSNP:rs1245281228)"
/evidence="ECO:0000269|PubMed:23033978"
/id="VAR_069422"
SEQUENCE 140 AA; 16131 MW; 601216B821A36DCE CRC64;
MDSRIPYDDY PVVFLPAYEN PPAWIPPHER VHHPDYNNEL TQFLPRTITL KKPPGAQLGF
NIRGGKASQL GIFISKVIPD SDAHRAGLQE GDQVLAVNDV DFQDIEHSKA VEILKTAREI
SMRVRFFPYN YHRQKERTVH


Related products :

Catalog number Product name Quantity
EIAAB34042 76 kDa Ral-interacting protein,Dinitrophenyl S-glutathione ATPase,DNP-SG ATPase,Homo sapiens,Human,RalA-binding protein 1,RalBP1,RALBP1,Ral-interacting protein 1,RLIP1,RLIP76
10-288-21983F Calcium and integrin-binding protein 1 - Calmyrin; DNA-PKcs-interacting protein; Kinase-interacting protein; KIP; CIB; SNK-interacting protein 2-28; SIP2-28 0.1 mg
10-288-21983F Calcium and integrin-binding protein 1 - Calmyrin; DNA-PKcs-interacting protein; Kinase-interacting protein; KIP; CIB; SNK-interacting protein 2-28; SIP2-28 0.05 mg
EIAAB39603 54 kDa VacA-interacting protein,90 kDa N-WASP-interacting protein,90 kDa SH3 protein interacting with Nck,Mouse,Mus musculus,NCK-interacting protein with SH3 domain,Nckipsd,N-WASP-binding protein,SH3
EIAAB27017 45 kDa NF-AT-interacting protein,45 kDa NFAT-interacting protein,Homo sapiens,Human,NFATC2-interacting protein,NFATC2IP,NIP45,Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein
EIAAB27018 45 kDa NF-AT-interacting protein,45 kDa NFAT-interacting protein,Mouse,Mus musculus,NFATC2-interacting protein,Nfatc2ip,Nip45,Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein
EIAAB27268 Mouse,Mus musculus,Na(+)_K(+)-transporting ATPase subunit beta-1-interacting protein 2,Nkain2,Sodium_potassium-transporting ATPase subunit beta-1-interacting protein 2,Tcba1,T-cell lymphoma breakpoint
EIAAB27269 FAM77B,Homo sapiens,Human,Na(+)_K(+)-transporting ATPase subunit beta-1-interacting protein 2,NKAIN2,Protein FAM77B,Sodium_potassium-transporting ATPase subunit beta-1-interacting protein 2,TCBA1,T-ce
EIAAB27273 C20orf58,FAM77A,Homo sapiens,Human,Na(+)_K(+)-transporting ATPase subunit beta-1-interacting protein 4,NKAIN4,Protein FAM77A,Sodium_potassium-transporting ATPase subunit beta-1-interacting protein 4
EIAAB27265 FAM77C,Homo sapiens,Human,Na(+)_K(+)-transporting ATPase subunit beta-1-interacting protein 1,NKAIN1,Protein FAM77C,Sodium_potassium-transporting ATPase subunit beta-1-interacting protein 1
EIAAB27271 FAM77D,Homo sapiens,Human,Na(+)_K(+)-transporting ATPase subunit beta-1-interacting protein 3,NKAIN3,Protein FAM77D,Sodium_potassium-transporting ATPase subunit beta-1-interacting protein 3
EIAAB31218 Homo sapiens,hPIP1,Human,p21-activated protein kinase-interacting protein 1,PAK_PLC-interacting protein 1,PAK1-interacting protein 1,PAK1IP1,PIP1,WD repeat-containing protein 84,WDR84
EIAAB39347 Mouse,Mus musculus,Spata24,Spermatogenesis-associated protein 24,TATA-binding protein-like factor-interacting protein,Testis protein T6441 homolog,Tipt,Tipt2,TLF-interacting protein,TRF2-interacting p
EIAAB46349 Homo sapiens,Human,Protein PRPL-2,WAS_WASL-interacting protein family member 1,WASP-interacting protein,WASPIP,WIP,WIPF1,Wiskott-Aldrich syndrome protein-interacting protein
EIAAB07420 Cdc42-interacting protein 4,CIP4,Homo sapiens,hSTP,Human,Protein Felic,Salt tolerant protein,STOT,STP,Thyroid receptor-interacting protein 10,TR-interacting protein 10,TRIP10,TRIP-10
15-288-22308F GIPC PDZ domain-containing protein 1 - RGS19-interacting protein 1; GAIP C-terminus-interacting protein; RGS-GAIP-interacting protein; Tax interaction protein 2; TIP-2 Polyclonal 0.05 mg
15-288-22308F GIPC PDZ domain-containing protein 1 - RGS19-interacting protein 1; GAIP C-terminus-interacting protein; RGS-GAIP-interacting protein; Tax interaction protein 2; TIP-2 Polyclonal 0.1 mg
18-003-44197 PDZ domain-containing protein GIPC1 - RGS19-interacting protein 1; GAIP C-terminus-interacting protein; RGS-GAIP-interacting protein; Tax interaction protein 2; TIP-2 Polyclonal 0.05 mg Aff Pur
EIAAB27270 Fam77d,Mouse,Mus musculus,Na(+)_K(+)-transporting ATPase subunit beta-1-interacting protein 3,Nkain3,Protein FAM77D,Sodium_potassium-transporting ATPase subunit beta-1-interacting protein 3
EIAAB27266 Fam77c,Mouse,Mus musculus,Na(+)_K(+)-transporting ATPase subunit beta-1-interacting protein 1,Nkain1,Protein FAM77C,Sodium_potassium-transporting ATPase subunit beta-1-interacting protein 1
EIAAB27272 Fam77a,Mouse,Mus musculus,Na(+)_K(+)-transporting ATPase subunit beta-1-interacting protein 4,Nkain4,Protein FAM77A,Sodium_potassium-transporting ATPase subunit beta-1-interacting protein 4
EIAAB27267 Bos taurus,Bovine,Na(+)_K(+)-transporting ATPase subunit beta-1-interacting protein 2,NKAIN2,Sodium_potassium-transporting ATPase subunit beta-1-interacting protein 2
EIAAB39604 54 kDa VacA-interacting protein,54 kDa vimentin-interacting protein,90 kDa SH3 protein interacting with Nck,AF3p21,AF3P21,Dia-interacting protein 1,Diaphanous protein-interacting protein,DIP-1,Homo sa
EIAAB31034 Androgen receptor-interacting protein 3,ARIP3,DAB2-interacting protein,DIP,E3 SUMO-protein ligase PIAS2,Homo sapiens,Human,Miz1,Msx-interacting zinc finger protein,PIAS2,PIAS-NY protein,PIASX,Protein
EIAAB46350 Mouse,Mus musculus,WAS_WASL-interacting protein family member 1,WASP-interacting protein,Waspip,Wip,Wipf1,Wiskott-Aldrich syndrome protein-interacting protein
Pathways :
WP2199: Seed Development
WP1689: Porphyrin and chlorophyll metabolism
WP1692: Protein export
WP1502: Mitochondrial biogenesis
WP1624: Bacterial secretion system
WP1714: Tyrosine metabolism
WP1665: Limonene and pinene degradation
WP1713: Two-component system
WP35: G Protein Signaling Pathways
WP1625: Base excision repair
WP1892: Protein folding
WP1165: G Protein Signaling Pathways
WP2032: TSH signaling pathway
WP731: Sterol regulatory element binding protein related
WP1657: Glycerolipid metabolism
WP1438: Influenza A virus infection
WP1700: Selenoamino acid metabolism
WP1663: Homologous recombination
WP2272: Pathogenic Escherichia coli infection
WP1673: Naphthalene and anthracene degradation
WP2324: AGE/RAGE pathway
WP1613: 1,4-Dichlorobenzene degradation
WP1888: Post-translational protein modification
WP1678: Nucleotide excision repair
WP346: Protein Modifications

Related Genes :
[MAGI2 ACVRINP1 AIP1 KIAA0705] Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (Atrophin-1-interacting protein 1) (AIP-1) (Atrophin-1-interacting protein A) (Membrane-associated guanylate kinase inverted 2) (MAGI-2)
[Magi2 Acvrinp1 Aip1 Sscam] Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (Atrophin-1-interacting protein 1) (AIP-1) (Membrane-associated guanylate kinase inverted 2) (MAGI-2) (Synaptic-scaffolding molecule) (S-SCAM)
[FRMPD4 KIAA0316 PDZD10 PDZK10] FERM and PDZ domain-containing protein 4 (PDZ domain-containing protein 10) (PSD-95-interacting regulator of spine morphogenesis) (Preso)
[Magi2 Acvrinp1 Aip1 Arip1] Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (Activin receptor-interacting protein 1) (Acvrip1) (Atrophin-1-interacting protein 1) (AIP-1) (Membrane-associated guanylate kinase inverted 2) (MAGI-2)
[PATJ CIPP INADL] InaD-like protein (Inadl protein) (hINADL) (Channel-interacting PDZ domain-containing protein) (Pals1-associated tight junction protein) (Protein associated to tight junctions)
[Patj Cipp Inadl] InaD-like protein (Inadl protein) (Channel-interacting PDZ domain-containing protein) (Pals1-associated tight junction protein) (Protein associated to tight junctions)
[PATJ CIPP INADL] InaD-like protein (Inadl protein) (Channel-interacting PDZ domain-containing protein) (Pals1-associated tight junction protein) (Protein associated to tight junctions)
[RAPGEF2 NRAPGEP PDZGEF1] Rap guanine nucleotide exchange factor 2 (Cyclic nucleotide ras GEF) (CNrasGEF) (Neural RAP guanine nucleotide exchange protein) (nRap GEP) (PDZ domain-containing guanine nucleotide exchange factor 1) (PDZ-GEF1) (RA-GEF-1) (Ras/Rap1-associating GEF-1)
[Rapgef2 Pdzgef1] Rap guanine nucleotide exchange factor 2 (Cyclic nucleotide ras GEF) (CNrasGEF) (Neural RAP guanine nucleotide exchange protein) (nRap GEP) (PDZ domain-containing guanine nucleotide exchange factor 1) (PDZ-GEF1) (RA-GEF-1) (Ras/Rap1-associating GEF-1)
[Synj2bp Arip2 Omp25] Synaptojanin-2-binding protein (Activin receptor-interacting protein 2) (Activin receptor-interacting protein 4) (Mitochondrial outer membrane protein 25)
[RAPGEF2 NRAPGEP PDZGEF1] Rap guanine nucleotide exchange factor 2 (Cyclic nucleotide ras GEF) (CNrasGEF) (Neural RAP guanine nucleotide exchange protein) (nRap GEP) (PDZ domain-containing guanine nucleotide exchange factor 1) (PDZ-GEF1) (RA-GEF-1) (Ras/Rap1-associating GEF-1)
[PDZD3 IKEPP NHERF4 PDZK2 DLNB27] Na(+)/H(+) exchange regulatory cofactor NHE-RF4 (NHERF-4) (Intestinal and kidney-enriched PDZ protein) (Natrium-phosphate cotransporter IIa C-terminal-associated protein 2) (Na/Pi cotransporter C-terminal-associated protein 2) (NaPi-Cap2) (PDZ domain-containing protein 2) (PDZ domain-containing protein 3) (Sodium-hydrogen exchanger regulatory factor 4)
[Pdzk1 Cap70 Nherf3] Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (NHERF-3) (CFTR-associated protein of 70 kDa) (Na(+)/H(+) exchanger regulatory factor 3) (Na/Pi cotransporter C-terminal-associated protein 1) (NaPi-Cap1) (PDZ domain-containing protein 1) (Sodium-hydrogen exchanger regulatory factor 3)
[Grip1] Glutamate receptor-interacting protein 1 (GRIP-1) (AMPA receptor-interacting protein GRIP1)
[RAPGEF2 KIAA0313 NRAPGEP PDZGEF1] Rap guanine nucleotide exchange factor 2 (Cyclic nucleotide ras GEF) (CNrasGEF) (Neural RAP guanine nucleotide exchange protein) (nRap GEP) (PDZ domain-containing guanine nucleotide exchange factor 1) (PDZ-GEF1) (RA-GEF-1) (Ras/Rap1-associating GEF-1)
[MPDZ MUPP1] Multiple PDZ domain protein (Multi-PDZ domain protein 1)
[Cask] Peripheral plasma membrane protein CASK (EC 2.7.11.1) (Calcium/calmodulin-dependent serine protein kinase)
[TRIP6 OIP1] Thyroid receptor-interacting protein 6 (TR-interacting protein 6) (TRIP-6) (Opa-interacting protein 1) (OIP-1) (Zyxin-related protein 1) (ZRP-1)
[Grip1] Glutamate receptor-interacting protein 1 (GRIP-1)
[Grip2] Glutamate receptor-interacting protein 2 (GRIP-2) (AMPA receptor-interacting protein GRIP2)
[Cit Crik] Citron Rho-interacting kinase (CRIK) (EC 2.7.11.1) (Rho-interacting, serine/threonine-protein kinase 21)
[MAGI3 KIAA1634] Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 (Membrane-associated guanylate kinase inverted 3) (MAGI-3)
[APBA1 MINT1 X11] Amyloid-beta A4 precursor protein-binding family A member 1 (Adapter protein X11alpha) (Neuron-specific X11 protein) (Neuronal Munc18-1-interacting protein 1) (Mint-1)
[Cit CRIK] Citron rho-interacting kinase (CRIK) (EC 2.7.11.1) (Rho-interacting, serine/threonine-protein kinase 21)
[APBA3 MINT3 X11L2] Amyloid-beta A4 precursor protein-binding family A member 3 (Adapter protein X11gamma) (Neuron-specific X11L2 protein) (Neuronal Munc18-1-interacting protein 3) (Mint-3)
[Rapgef2 Kiaa0313 Pdzgef1] Rap guanine nucleotide exchange factor 2 (Cyclic nucleotide ras GEF) (CNrasGEF) (Neural RAP guanine nucleotide exchange protein) (nRap GEP) (PDZ domain-containing guanine nucleotide exchange factor 1) (PDZ-GEF1) (RA-GEF-1) (Ras/Rap1-associating GEF-1)
[Zasp52 Zasp CG30084] PDZ and LIM domain protein Zasp (Z band alternatively spliced PDZ-motif protein)
[Nos1ap Capon] Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (C-terminal PDZ ligand of neuronal nitric oxide synthase protein) (Nitric oxide synthase 1 adaptor protein)
[NOS1AP CAPON KIAA0464] Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (C-terminal PDZ ligand of neuronal nitric oxide synthase protein) (Nitric oxide synthase 1 adaptor protein)
[Nos1ap Capon Kiaa0464] Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (C-terminal PDZ ligand of neuronal nitric oxide synthase protein) (Nitric oxide synthase 1 adaptor protein)

Bibliography :
No related Items