GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Periostin (PN) (Osteoblast-specific factor 2) (OSF-2)

 POSTN_HUMAN             Reviewed;         836 AA.
Q15063; B1ALD8; C0IMJ1; C0IMJ2; C0IMJ4; D2KRH7; F5H628; Q15064;
Q29XZ0; Q3KPJ5; Q5VSY5; Q8IZF9;
26-APR-2004, integrated into UniProtKB/Swiss-Prot.
07-MAR-2006, sequence version 2.
03-JUL-2019, entry version 171.
RecName: Full=Periostin;
Short=PN;
AltName: Full=Osteoblast-specific factor 2;
Short=OSF-2;
Flags: Precursor;
Name=POSTN; Synonyms=OSF2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1] {ECO:0000305}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
TISSUE=Osteosarcoma {ECO:0000269|PubMed:8363580}, and
Placenta {ECO:0000269|PubMed:8363580};
PubMed=8363580; DOI=10.1042/bj2940271;
Takeshita S., Kikuno R., Tezuka K., Amann E.;
"Osteoblast-specific factor 2: cloning of a putative bone adhesion
protein with homology with the insect protein fasciclin I.";
Biochem. J. 294:271-278(1993).
[2] {ECO:0000305}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR
LOCATION, AND TISSUE SPECIFICITY.
PubMed=12235007;
Gillan L., Matei D., Fishman D.A., Gerbin C.S., Karlan B.Y.,
Chang D.D.;
"Periostin secreted by epithelial ovarian carcinoma is a ligand for
alpha(V)beta(3) and alpha(V)beta(5) integrins and promotes cell
motility.";
Cancer Res. 62:5358-5364(2002).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5; 6; 7), ALTERNATIVE SPLICING,
AND TISSUE SPECIFICITY.
PubMed=23946676; DOI=10.4137/JCM.S5899;
Bai Y., Nakamura M., Zhou G., Li Y., Liu Z., Ozaki T., Mori I.,
Kakudo K.;
"Novel isoforms of periostin expressed in the human thyroid.";
Jpn. Clin. Med. 1:13-20(2010).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
TISSUE=Periodontal ligament;
Yamada S., Maeda K., Matsubara K., Murakami S.;
"Identification and characterization of a novel periodontal ligament-
specific periostin isoform.";
Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057823; DOI=10.1038/nature02379;
Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L.,
Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E.,
Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E.,
Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.,
Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R.,
Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S.,
Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P.,
Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M.,
Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J.,
Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E.,
Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L.,
Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J.,
Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S.,
Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J.,
Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M.,
King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A.,
Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S.,
Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S.,
Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I.,
Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S.,
Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A.,
Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B.,
Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L.,
Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M.,
Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.;
"The DNA sequence and analysis of human chromosome 13.";
Nature 428:522-528(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
NUCLEOTIDE SEQUENCE [MRNA] OF 1-798 (ISOFORM 5).
Habtemichael N., Schweitzer A., Knauer S., Stauber R.H.;
"OSF-2 expression in head and neck squamous cell carcinomas.";
Submitted (NOV-2009) to the EMBL/GenBank/DDBJ databases.
[9] {ECO:0000305}
TISSUE SPECIFICITY.
PubMed=11550156;
DOI=10.1002/1097-0142(20010815)92:4<843::AID-CNCR1391>3.0.CO;2-P;
Sasaki H., Dai M., Auclair D., Fukai I., Kiriyama M., Yamakawa Y.,
Fujii Y., Chen L.B.;
"Serum level of the periostin, a homologue of an insect cell adhesion
molecule, as a prognostic marker in nonsmall cell lung carcinomas.";
Cancer 92:843-848(2001).
[10]
ERRATUM.
Sasaki H., Dai M., Auclair D., Fukai I., Kiriyama M., Yamakawa Y.,
Fujii Y., Chen L.B.;
Cancer 95:2580-2580(2002).
[11]
TISSUE SPECIFICITY.
PubMed=15082792; DOI=10.1128/MCB.24.9.3992-4003.2004;
Shao R., Bao S., Bai X., Blanchette C., Anderson R.M., Dang T.,
Gishizky M.L., Marks J.R., Wang X.-F.;
"Acquired expression of periostin by human breast cancers promotes
tumor angiogenesis through up-regulation of vascular endothelial
growth factor receptor 2 expression.";
Mol. Cell. Biol. 24:3992-4003(2004).
[12]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599.
TISSUE=Plasma;
PubMed=16335952; DOI=10.1021/pr0502065;
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,
Moore R.J., Smith R.D.;
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,
hydrazide chemistry, and mass spectrometry.";
J. Proteome Res. 4:2070-2080(2005).
[13]
SUBCELLULAR LOCATION, AND GAMMA-CARBOXYGLUTAMATION.
PubMed=18450759; DOI=10.1074/jbc.M708029200;
Coutu D.L., Wu J.H., Monette A., Rivard G.-E., Blostein M.D.,
Galipeau J.;
"Periostin, a member of a novel family of vitamin K-dependent
proteins, is expressed by mesenchymal stromal cells.";
J. Biol. Chem. 283:17991-18001(2008).
[14]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599.
TISSUE=Liver;
PubMed=19159218; DOI=10.1021/pr8008012;
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
"Glycoproteomics analysis of human liver tissue by combination of
multiple enzyme digestion and hydrazide chemistry.";
J. Proteome Res. 8:651-661(2009).
[15]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[16]
SUBCELLULAR LOCATION, AND LACK OF GAMMA-CARBOXYGLUTAMATION.
PubMed=26273833; DOI=10.1371/journal.pone.0135374;
Annis D.S., Ma H., Balas D.M., Kumfer K.T., Sandbo N., Potts G.K.,
Coon J.J., Mosher D.F.;
"Absence of vitamin K-dependent gamma-carboxylation in human periostin
extracted from fibrotic lung or secreted from a cell line engineered
to optimize gamma-carboxylation.";
PLoS ONE 10:E0135374-E0135374(2015).
-!- FUNCTION: Induces cell attachment and spreading and plays a role
in cell adhesion (PubMed:12235007). Enhances incorporation of BMP1
in the fibronectin matrix of connective tissues, and subsequent
proteolytic activation of lysyl oxidase LOX (By similarity).
{ECO:0000250|UniProtKB:Q62009, ECO:0000269|PubMed:12235007}.
-!- SUBUNIT: Interacts with BMP1 and fibronectin.
{ECO:0000250|UniProtKB:Q62009}.
-!- SUBCELLULAR LOCATION: Golgi apparatus
{ECO:0000250|UniProtKB:Q62009}. Secreted
{ECO:0000269|PubMed:18450759, ECO:0000269|PubMed:26273833}.
Secreted, extracellular space, extracellular matrix
{ECO:0000269|PubMed:12235007, ECO:0000269|PubMed:18450759}.
Note=Colocalizes with BMP1 in the Golgi.
{ECO:0000250|UniProtKB:Q62009}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=7;
Name=1 {ECO:0000269|PubMed:8363580}; Synonyms=OSF-2OS
{ECO:0000303|PubMed:8363580};
IsoId=Q15063-1; Sequence=Displayed;
Name=2 {ECO:0000269|PubMed:8363580}; Synonyms=OSF-2p1;
IsoId=Q15063-2; Sequence=VSP_050005;
Name=3 {ECO:0000269|PubMed:12235007};
IsoId=Q15063-3; Sequence=VSP_050669, VSP_050670;
Name=4;
IsoId=Q15063-4; Sequence=VSP_050005, VSP_050670;
Name=5;
IsoId=Q15063-5; Sequence=VSP_050669;
Name=6;
IsoId=Q15063-6; Sequence=VSP_055183;
Name=7;
IsoId=Q15063-7; Sequence=VSP_055183, VSP_050670;
-!- TISSUE SPECIFICITY: Widely expressed with highest levels in aorta,
stomach, lower gastrointestinal tract, placenta, uterus, thyroid
tissue and breast. Up-regulated in epithelial ovarian tumors. Not
expressed in normal ovaries. Also highly expressed at the tumor
periphery of lung carcinoma tissue but not within the tumor.
Overexpressed in breast cancers. {ECO:0000269|PubMed:11550156,
ECO:0000269|PubMed:12235007, ECO:0000269|PubMed:15082792,
ECO:0000269|PubMed:23946676}.
-!- PTM: Gamma-carboxylation is controversial. Gamma-
carboxyglutamated; gamma-carboxyglutamate residues are formed by
vitamin K dependent carboxylation; this may be required for
calcium binding (PubMed:18450759). According to a more recent
report, does not contain vitamin K-dependent gamma-
carboxyglutamate residues (PubMed:26273833).
{ECO:0000269|PubMed:18450759, ECO:0000269|PubMed:26273833}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; D13665; BAA02836.1; -; mRNA.
EMBL; D13666; BAA02837.1; -; mRNA.
EMBL; AY140646; AAN17733.1; -; mRNA.
EMBL; EU262883; ABY86630.1; -; mRNA.
EMBL; EU262884; ABY86631.1; -; mRNA.
EMBL; EU262886; ABY86633.1; -; mRNA.
EMBL; AY918092; AAY15840.1; -; mRNA.
EMBL; AL138679; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL646087; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471075; EAX08590.1; -; Genomic_DNA.
EMBL; BC106709; AAI06710.1; -; mRNA.
EMBL; BC106710; AAI06711.1; -; mRNA.
EMBL; GU354210; ADA79517.1; -; mRNA.
CCDS; CCDS45034.1; -. [Q15063-2]
CCDS; CCDS53864.1; -. [Q15063-3]
CCDS; CCDS66530.1; -. [Q15063-6]
CCDS; CCDS66531.1; -. [Q15063-5]
CCDS; CCDS9364.1; -. [Q15063-1]
PIR; S36110; S36110.
PIR; S36111; S36111.
RefSeq; NP_001129406.1; NM_001135934.1. [Q15063-2]
RefSeq; NP_001129407.1; NM_001135935.1. [Q15063-3]
RefSeq; NP_001129408.1; NM_001135936.1. [Q15063-4]
RefSeq; NP_001273594.1; NM_001286665.1. [Q15063-5]
RefSeq; NP_001273595.1; NM_001286666.1. [Q15063-6]
RefSeq; NP_001273596.1; NM_001286667.1. [Q15063-7]
RefSeq; NP_001317446.1; NM_001330517.1.
RefSeq; NP_006466.2; NM_006475.2. [Q15063-1]
PDB; 5WT7; NMR; -; A=496-632.
PDB; 5YJG; X-ray; 2.40 A; A=22-631.
PDB; 5YJH; X-ray; 2.96 A; A=17-631.
PDBsum; 5WT7; -.
PDBsum; 5YJG; -.
PDBsum; 5YJH; -.
SMR; Q15063; -.
BioGrid; 115875; 5.
IntAct; Q15063; 3.
MINT; Q15063; -.
STRING; 9606.ENSP00000369071; -.
GlyConnect; 1599; -.
iPTMnet; Q15063; -.
PhosphoSitePlus; Q15063; -.
BioMuta; POSTN; -.
DMDM; 93138709; -.
jPOST; Q15063; -.
MaxQB; Q15063; -.
PaxDb; Q15063; -.
PeptideAtlas; Q15063; -.
PRIDE; Q15063; -.
ProteomicsDB; 60417; -.
ProteomicsDB; 60418; -. [Q15063-2]
ProteomicsDB; 60419; -. [Q15063-3]
ProteomicsDB; 60420; -. [Q15063-4]
Ensembl; ENST00000379742; ENSP00000369066; ENSG00000133110. [Q15063-2]
Ensembl; ENST00000379743; ENSP00000369067; ENSG00000133110. [Q15063-5]
Ensembl; ENST00000379747; ENSP00000369071; ENSG00000133110. [Q15063-1]
Ensembl; ENST00000541179; ENSP00000437959; ENSG00000133110. [Q15063-3]
Ensembl; ENST00000541481; ENSP00000437953; ENSG00000133110. [Q15063-6]
GeneID; 10631; -.
KEGG; hsa:10631; -.
UCSC; uc001uwo.5; human. [Q15063-1]
CTD; 10631; -.
DisGeNET; 10631; -.
GeneCards; POSTN; -.
HGNC; HGNC:16953; POSTN.
HPA; HPA012306; -.
MIM; 608777; gene.
neXtProt; NX_Q15063; -.
OpenTargets; ENSG00000133110; -.
PharmGKB; PA134900304; -.
eggNOG; KOG1437; Eukaryota.
eggNOG; COG2335; LUCA.
GeneTree; ENSGT00530000063860; -.
HOGENOM; HOG000220865; -.
InParanoid; Q15063; -.
OMA; KTEGPTI; -.
OrthoDB; 1437416at2759; -.
PhylomeDB; Q15063; -.
TreeFam; TF316269; -.
SIGNOR; Q15063; -.
ChiTaRS; POSTN; human.
GeneWiki; Periostin; -.
GeneWiki; POSTN; -.
GenomeRNAi; 10631; -.
PRO; PR:Q15063; -.
Proteomes; UP000005640; Chromosome 13.
Bgee; ENSG00000133110; Expressed in 203 organ(s), highest expression level in periodontal ligament.
ExpressionAtlas; Q15063; baseline and differential.
Genevisible; Q15063; HS.
GO; GO:0062023; C:collagen-containing extracellular matrix; IDA:UniProtKB.
GO; GO:0031012; C:extracellular matrix; ISS:UniProtKB.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0031594; C:neuromuscular junction; IEA:Ensembl.
GO; GO:0005802; C:trans-Golgi network; IDA:BHF-UCL.
GO; GO:0050839; F:cell adhesion molecule binding; IBA:GO_Central.
GO; GO:0008201; F:heparin binding; ISS:UniProtKB.
GO; GO:0046872; F:metal ion binding; IDA:UniProtKB.
GO; GO:1990523; P:bone regeneration; IEA:Ensembl.
GO; GO:0007155; P:cell adhesion; IDA:UniProtKB.
GO; GO:0044344; P:cellular response to fibroblast growth factor stimulus; IEA:Ensembl.
GO; GO:0071560; P:cellular response to transforming growth factor beta stimulus; IEA:Ensembl.
GO; GO:0071356; P:cellular response to tumor necrosis factor; IEA:Ensembl.
GO; GO:0071307; P:cellular response to vitamin K; IDA:UniProtKB.
GO; GO:0030198; P:extracellular matrix organization; IBA:GO_Central.
GO; GO:0001953; P:negative regulation of cell-matrix adhesion; IEA:Ensembl.
GO; GO:1900025; P:negative regulation of substrate adhesion-dependent cell spreading; IEA:Ensembl.
GO; GO:1990138; P:neuron projection extension; IEA:Ensembl.
GO; GO:1904209; P:positive regulation of chemokine (C-C motif) ligand 2 secretion; IEA:Ensembl.
GO; GO:0014911; P:positive regulation of smooth muscle cell migration; IEA:Ensembl.
GO; GO:0008593; P:regulation of Notch signaling pathway; IEA:Ensembl.
GO; GO:0003073; P:regulation of systemic arterial blood pressure; IEA:Ensembl.
GO; GO:0032355; P:response to estradiol; IEA:Ensembl.
GO; GO:0001666; P:response to hypoxia; IEA:Ensembl.
GO; GO:0009612; P:response to mechanical stimulus; IEA:Ensembl.
GO; GO:0014850; P:response to muscle activity; IEA:Ensembl.
Gene3D; 2.30.180.10; -; 4.
InterPro; IPR011489; EMI_domain.
InterPro; IPR036378; FAS1_dom_sf.
InterPro; IPR000782; FAS1_domain.
InterPro; IPR016666; TGFBI/POSTN.
Pfam; PF02469; Fasciclin; 4.
PIRSF; PIRSF016553; BIGH3_OSF2; 1.
SMART; SM00554; FAS1; 4.
SUPFAM; SSF82153; SSF82153; 4.
PROSITE; PS51041; EMI; 1.
PROSITE; PS50213; FAS1; 4.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cell adhesion; Complete proteome;
Disulfide bond; Extracellular matrix; Gamma-carboxyglutamic acid;
Glycoprotein; Golgi apparatus; Heparin-binding; Polymorphism;
Reference proteome; Repeat; Secreted; Signal.
SIGNAL 1 21 {ECO:0000255}.
CHAIN 22 836 Periostin.
/FTId=PRO_0000008789.
DOMAIN 40 94 EMI. {ECO:0000255|PROSITE-
ProRule:PRU00384}.
DOMAIN 97 230 FAS1 1. {ECO:0000255|PROSITE-
ProRule:PRU00082, ECO:0000305}.
DOMAIN 234 365 FAS1 2. {ECO:0000255|PROSITE-
ProRule:PRU00082, ECO:0000305}.
DOMAIN 368 492 FAS1 3. {ECO:0000255|PROSITE-
ProRule:PRU00082, ECO:0000305}.
DOMAIN 496 628 FAS1 4. {ECO:0000255|PROSITE-
ProRule:PRU00082, ECO:0000305}.
CARBOHYD 599 599 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16335952,
ECO:0000269|PubMed:19159218}.
DISULFID 44 80 {ECO:0000255|PROSITE-ProRule:PRU00384}.
DISULFID 60 69 {ECO:0000255|PROSITE-ProRule:PRU00384}.
DISULFID 79 92 {ECO:0000255|PROSITE-ProRule:PRU00384}.
VAR_SEQ 670 757 TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPE
FRLIKEGETITEVIHGEPIIKKYTKIIDGVPVEITEKETRE
ERIITG -> S (in isoform 6 and isoform 7).
{ECO:0000303|PubMed:23946676}.
/FTId=VSP_055183.
VAR_SEQ 670 727 TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPE
FRLIKEGETITEVIHGE -> K (in isoform 2 and
isoform 4). {ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:8363580,
ECO:0000303|Ref.4}.
/FTId=VSP_050005.
VAR_SEQ 670 697 TTKIITKVVEPKIKVIEGSLQPIIKTEG -> R (in
isoform 3 and isoform 5).
{ECO:0000303|PubMed:12235007,
ECO:0000303|PubMed:23946676,
ECO:0000303|Ref.8}.
/FTId=VSP_050669.
VAR_SEQ 783 810 Missing (in isoform 3, isoform 4 and
isoform 7). {ECO:0000303|PubMed:12235007,
ECO:0000303|PubMed:23946676,
ECO:0000303|Ref.4}.
/FTId=VSP_050670.
VARIANT 339 339 T -> I (in dbSNP:rs9594223).
/FTId=VAR_049115.
VARIANT 814 814 V -> M (in dbSNP:rs9547952).
/FTId=VAR_049116.
CONFLICT 290 290 I -> F (in Ref. 1; BAA02836/BAA02837, 3;
ABY86630/ABY86631/ABY86633 and 4;
AAY15840). {ECO:0000305}.
CONFLICT 421 421 D -> V (in Ref. 1; BAA02836/BAA02837, 3;
ABY86630/ABY86631/ABY86633 and 4;
AAY15840). {ECO:0000305}.
STRAND 43 49 {ECO:0000244|PDB:5YJG}.
STRAND 55 62 {ECO:0000244|PDB:5YJG}.
STRAND 73 79 {ECO:0000244|PDB:5YJG}.
HELIX 101 107 {ECO:0000244|PDB:5YJG}.
HELIX 111 119 {ECO:0000244|PDB:5YJG}.
HELIX 123 126 {ECO:0000244|PDB:5YJG}.
STRAND 128 130 {ECO:0000244|PDB:5YJG}.
STRAND 132 137 {ECO:0000244|PDB:5YJG}.
HELIX 139 144 {ECO:0000244|PDB:5YJG}.
HELIX 147 154 {ECO:0000244|PDB:5YJG}.
TURN 157 159 {ECO:0000244|PDB:5YJG}.
HELIX 160 167 {ECO:0000244|PDB:5YJG}.
STRAND 169 172 {ECO:0000244|PDB:5YJG}.
HELIX 176 178 {ECO:0000244|PDB:5YJG}.
STRAND 184 186 {ECO:0000244|PDB:5YJG}.
STRAND 193 198 {ECO:0000244|PDB:5YJG}.
STRAND 204 206 {ECO:0000244|PDB:5YJG}.
STRAND 209 218 {ECO:0000244|PDB:5YJG}.
STRAND 221 228 {ECO:0000244|PDB:5YJG}.
HELIX 237 243 {ECO:0000244|PDB:5YJG}.
HELIX 245 247 {ECO:0000244|PDB:5YJG}.
HELIX 248 257 {ECO:0000244|PDB:5YJG}.
HELIX 262 264 {ECO:0000244|PDB:5YJG}.
STRAND 265 267 {ECO:0000244|PDB:5YJG}.
STRAND 269 274 {ECO:0000244|PDB:5YJG}.
HELIX 276 281 {ECO:0000244|PDB:5YJG}.
HELIX 286 292 {ECO:0000244|PDB:5YJG}.
HELIX 294 302 {ECO:0000244|PDB:5YJG}.
STRAND 305 308 {ECO:0000244|PDB:5YJG}.
HELIX 312 314 {ECO:0000244|PDB:5YJG}.
STRAND 319 323 {ECO:0000244|PDB:5YJG}.
STRAND 326 334 {ECO:0000244|PDB:5YJG}.
STRAND 337 340 {ECO:0000244|PDB:5YJG}.
STRAND 346 353 {ECO:0000244|PDB:5YJG}.
STRAND 356 363 {ECO:0000244|PDB:5YJG}.
HELIX 368 370 {ECO:0000244|PDB:5YJG}.
HELIX 373 376 {ECO:0000244|PDB:5YJG}.
HELIX 379 381 {ECO:0000244|PDB:5YJG}.
HELIX 382 390 {ECO:0000244|PDB:5YJG}.
HELIX 394 396 {ECO:0000244|PDB:5YJG}.
STRAND 403 408 {ECO:0000244|PDB:5YJG}.
HELIX 410 412 {ECO:0000244|PDB:5YJG}.
HELIX 415 418 {ECO:0000244|PDB:5YJG}.
HELIX 422 430 {ECO:0000244|PDB:5YJG}.
STRAND 433 436 {ECO:0000244|PDB:5YJG}.
HELIX 440 442 {ECO:0000244|PDB:5YJG}.
STRAND 448 451 {ECO:0000244|PDB:5YJG}.
STRAND 456 461 {ECO:0000244|PDB:5YJG}.
STRAND 466 468 {ECO:0000244|PDB:5YJG}.
STRAND 471 473 {ECO:0000244|PDB:5YJG}.
STRAND 481 490 {ECO:0000244|PDB:5YJG}.
HELIX 499 505 {ECO:0000244|PDB:5YJG}.
HELIX 507 509 {ECO:0000244|PDB:5YJG}.
HELIX 510 518 {ECO:0000244|PDB:5YJG}.
HELIX 522 526 {ECO:0000244|PDB:5YJG}.
STRAND 527 529 {ECO:0000244|PDB:5WT7}.
STRAND 531 536 {ECO:0000244|PDB:5YJG}.
HELIX 538 542 {ECO:0000244|PDB:5YJG}.
TURN 543 546 {ECO:0000244|PDB:5YJG}.
HELIX 547 553 {ECO:0000244|PDB:5YJG}.
HELIX 558 564 {ECO:0000244|PDB:5YJG}.
STRAND 567 570 {ECO:0000244|PDB:5YJG}.
HELIX 574 576 {ECO:0000244|PDB:5YJG}.
STRAND 582 586 {ECO:0000244|PDB:5YJG}.
STRAND 590 598 {ECO:0000244|PDB:5YJG}.
STRAND 601 606 {ECO:0000244|PDB:5YJG}.
STRAND 614 616 {ECO:0000244|PDB:5YJG}.
STRAND 619 626 {ECO:0000244|PDB:5YJG}.
SEQUENCE 836 AA; 93314 MW; 55E7B82D094824FD CRC64;
MIPFLPMFSL LLLLIVNPIN ANNHYDKILA HSRIRGRDQG PNVCALQQIL GTKKKYFSTC
KNWYKKSICG QKTTVLYECC PGYMRMEGMK GCPAVLPIDH VYGTLGIVGA TTTQRYSDAS
KLREEIEGKG SFTYFAPSNE AWDNLDSDIR RGLESNVNVE LLNALHSHMI NKRMLTKDLK
NGMIIPSMYN NLGLFINHYP NGVVTVNCAR IIHGNQIATN GVVHVIDRVL TQIGTSIQDF
IEAEDDLSSF RAAAITSDIL EALGRDGHFT LFAPTNEAFE KLPRGVLERI MGDKVASEAL
MKYHILNTLQ CSESIMGGAV FETLEGNTIE IGCDGDSITV NGIKMVNKKD IVTNNGVIHL
IDQVLIPDSA KQVIELAGKQ QTTFTDLVAQ LGLASALRPD GEYTLLAPVN NAFSDDTLSM
DQRLLKLILQ NHILKVKVGL NELYNGQILE TIGGKQLRVF VYRTAVCIEN SCMEKGSKQG
RNGAIHIFRE IIKPAEKSLH EKLKQDKRFS TFLSLLEAAD LKELLTQPGD WTLFVPTNDA
FKGMTSEEKE ILIRDKNALQ NIILYHLTPG VFIGKGFEPG VTNILKTTQG SKIFLKEVND
TLLVNELKSK ESDIMTTNGV IHVVDKLLYP ADTPVGNDQL LEILNKLIKY IQIKFVRGST
FKEIPVTVYT TKIITKVVEP KIKVIEGSLQ PIIKTEGPTL TKVKIEGEPE FRLIKEGETI
TEVIHGEPII KKYTKIIDGV PVEITEKETR EERIITGPEI KYTRISTGGG ETEETLKKLL
QEEVTKVTKF IEGGDGHLFE DEEIKRLLQG DTPVRKLQAN KKVQGSRRRL REGRSQ


Related products :

Catalog number Product name Quantity
ARP41571_P050 POSTN(periostin, osteoblast specific factor) 50 µg
10-663-45274 Periostin Human - PN; Osteoblast-specific factor 2; OSF-2 N_A 0.002 mg
10-663-45274 Periostin Human - PN; Osteoblast-specific factor 2; OSF-2 N_A 1 mg
PC-420 Osteoblast Specific Factor 2 (OSF_2, Periostin, Fasciclin_1 like) 50 ug
PC-420 Osteoblast Specific Factor 2 (OSF_2, Periostin, Fasciclin_1 like) 50 ug
10-663-45274 Periostin Human - PN; Osteoblast-specific factor 2; OSF-2 N_A 0.01 mg
PC-420 Osteoblast Specific Factor 2 (OSF_2, Periostin, Fasciclin_1 like) Polyclonal 50 ug
POTEA POSTN Gene periostin, osteoblast specific factor
CSB-EL018381RA Rat periostin per osteoblast specific factor 2 (POSTN) ELISA kit 96T
CSB-E16444h Human periostin per osteoblast specific factor 2 (POSTN) ELISA kit 96T
CSB-E16444h Human Periostin (Osteoblast Specific Factor 2) ELISA Kit SpeciesHuman 96T
CSB-EL018381MO Mouse periostin per osteoblast specific factor 2 (POSTN) ELISA kit 96T
PC-420 Antibodies: Osteoblast Specific Factor 2 (OSF-2, Periostin, Fasciclin-1 like) Clone: Polyclonal 50 ug
PC-420 Osteoblast Specific Factor 2 (OSF_2, Periostin, Fasciclin_1 like) Clone Polyclonal 50 ug
201-20-4375 POSTN{Homo sapiens periostin, osteoblast specific factor, ORF.}rabbit.pAb 0.2ml
U1767m CLIA Mouse,Mus musculus,Osf2,OSF-2,Osteoblast-specific factor 2,Periostin,PN,Postn 96T
E1767m ELISA kit Mouse,Mus musculus,Osf2,OSF-2,Osteoblast-specific factor 2,Periostin,PN,Postn 96T
E1767m ELISA Mouse,Mus musculus,Osf2,OSF-2,Osteoblast-specific factor 2,Periostin,PN,Postn 96T
U1767h CLIA Homo sapiens,Human,OSF2,OSF-2,Osteoblast-specific factor 2,Periostin,PN,POSTN 96T
E1767h ELISA Homo sapiens,Human,OSF2,OSF-2,Osteoblast-specific factor 2,Periostin,PN,POSTN 96T
E1767h ELISA kit Homo sapiens,Human,OSF2,OSF-2,Osteoblast-specific factor 2,Periostin,PN,POSTN 96T
CSB-EL018381HU Human Periostin (Osteoblast Specific Factor 2) ELISA Kit, Species Human, Sample Type serum, plasma 96T
CSB-EL018381MO Mouse periostin, osteoblast specific factor (POSTN) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
BC-235 Osteoblast Specific Factor 2 (OSF_2) 100 ug
RD172044100 Osteoblast Specific Factor 1 0.1 mg
Pathways :
WP927: Signaling of Hepatocyte Growth Factor Receptor
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP1899: Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs)
WP2148: Brain derived neurotrophic factor
WP272: Blood Clotting Cascade
WP1046: Signaling of Hepatocyte Growth Factor Receptor
WP444: Signaling of Hepatocyte Growth Factor Receptor
WP837: Osteoblast
WP1190: Osteoblast
WP1789: Binding of RNA by Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs)
WP956: Osteoblast
WP1983: Splicing factor NOVA regulated synpatic proteins
WP238: Osteoblast
WP322: Osteoblast Signaling
WP810: Signaling of Hepatocyte Growth Factor Receptor
WP1162: Signaling of Hepatocyte Growth Factor Receptor
WP1235: Signaling of Hepatocyte Growth Factor Receptor
WP94: Signaling of Hepatocyte Growth Factor Receptor
WP193: Signaling of Hepatocyte Growth Factor Receptor
WP227: Osteoblast
WP313: Signaling of Hepatocyte Growth Factor Receptor
WP1074: Osteoblast
WP566: canonical wnt - zebrafish

Related Genes :
[POSTN OSF2] Periostin (PN) (Osteoblast-specific factor 2) (OSF-2)
[RUNX2 AML3 CBFA1 OSF2 PEBP2A] Runt-related transcription factor 2 (Acute myeloid leukemia 3 protein) (Core-binding factor subunit alpha-1) (CBF-alpha-1) (Oncogene AML-3) (Osteoblast-specific transcription factor 2) (OSF-2) (Polyomavirus enhancer-binding protein 2 alpha A subunit) (PEA2-alpha A) (PEBP2-alpha A) (SL3-3 enhancer factor 1 alpha A subunit) (SL3/AKV core-binding factor alpha A subunit)
[Ptn] Pleiotrophin (PTN) (Heparin-binding brain mitogen) (HBBM) (Heparin-binding growth factor 8) (HBGF-8) (Heparin-binding growth-associated molecule) (HB-GAM) (Heparin-binding neutrophic factor) (HBNF) (Osteoblast-specific factor 1) (OSF-1)
[PTN HBNF1 NEGF1] Pleiotrophin (PTN) (Heparin-binding brain mitogen) (HBBM) (Heparin-binding growth factor 8) (HBGF-8) (Heparin-binding growth-associated molecule) (HB-GAM) (Heparin-binding neurite outgrowth-promoting factor) (HBNF) (Heparin-binding neurite outgrowth-promoting factor 1) (HBNF-1) (Osteoblast-specific factor 1) (OSF-1)
[Ptn] Pleiotrophin (PTN) (Heparin-binding brain mitogen) (HBBM) (Heparin-binding growth factor 8) (HBGF-8) (Heparin-binding growth-associated molecule) (HB-GAM) (Heparin-binding neutrophic factor) (HBNF) (Osteoblast-specific factor 1) (OSF-1)
[MEF2C] Myocyte-specific enhancer factor 2C (Myocyte enhancer factor 2C)
[Mef2c] Myocyte-specific enhancer factor 2C (Myocyte enhancer factor 2C)
[Eif2ak2 Pkr Prkr Tik] Interferon-induced, double-stranded RNA-activated protein kinase (EC 2.7.11.1) (Eukaryotic translation initiation factor 2-alpha kinase 2) (eIF-2A protein kinase 2) (Interferon-inducible RNA-dependent protein kinase) (P1/eIF-2A protein kinase) (Protein kinase RNA-activated) (PKR) (Protein kinase R) (Serine/threonine-protein kinase TIK) (Tyrosine-protein kinase EIF2AK2) (EC 2.7.10.2) (p68 kinase)
[Cbfb Pebp2b Pebpb2] Core-binding factor subunit beta (CBF-beta) (Polyomavirus enhancer-binding protein 2 beta subunit) (PEA2-beta) (PEBP2-beta) (SL3-3 enhancer factor 1 subunit beta) (SL3/AKV core-binding factor beta subunit)
[Tnf Tnfa Tnfsf2] Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form]
[Mef2c] Myocyte-specific enhancer factor 2C (Myocyte enhancer factor 2C)
[TMEM119 PSEC0199 UNQ731/PRO1415] Transmembrane protein 119 (Osteoblast induction factor) (OBIF)
[MEF2C] Myocyte-specific enhancer factor 2C
[MEF2C] Myocyte-specific enhancer factor 2C
[MEF2C] Myocyte-specific enhancer factor 2C
[Mef2d] Myocyte-specific enhancer factor 2D
[MEF2D] Myocyte-specific enhancer factor 2D
[TNF TNFA TNFSF2] Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form]
[lin-26 lin-26B F18A1.2] Transcription factor lin-26 (Abnormal cell lineage protein 26)
[MEF2C CR201_G0024381] MEF2C isoform 12 (MEF2C isoform 13) (MEF2C isoform 5) (MEF2C isoform 9) (Myocyte-specific enhancer factor 2C)
[MEF2C] Myocyte-specific enhancer factor 2C
[Mef2c] Myocyte-specific enhancer factor 2C
[Mef2c] myocyte-specific enhancer factor 2C isoform X5
[MEF2C RLOC_00012408] Myocyte-specific enhancer factor 2C
[MEF2C] Myocyte-specific enhancer factor 2C isoform 3
[MEF2C] Myocyte-specific enhancer factor 2C
[MEF2C] myocyte-specific enhancer factor 2C isoform X3
[TGFBI BIGH3] Transforming growth factor-beta-induced protein ig-h3 (Beta ig-h3) (Kerato-epithelin) (RGD-containing collagen-associated protein) (RGD-CAP)
[SVEP1 C9orf13 CCP22 SELOB] Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (CCP module-containing protein 22) (Polydom) (Selectin-like osteoblast-derived protein) (SEL-OB) (Serologically defined breast cancer antigen NY-BR-38)
[FGFR2 BEK KGFR KSAM] Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332)

Bibliography :
[28977942] Periostin promotes epithelial-mesenchymal transition via the MAPK/miR-381 axis in lung cancer.
[27028305] High-level expression of periostin is significantly correlated with tumour angiogenesis and poor prognosis in osteosarcoma.