GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Polycomb protein SCMH1 (Sex comb on midleg homolog 1)

 SCMH1_HUMAN             Reviewed;         660 AA.
Q96GD3; B4DRQ8; Q5VT76; Q6IAJ4; Q8WU48; Q9UKM5; Q9UKM6;
01-MAR-2005, integrated into UniProtKB/Swiss-Prot.
01-DEC-2001, sequence version 1.
13-FEB-2019, entry version 154.
RecName: Full=Polycomb protein SCMH1;
AltName: Full=Sex comb on midleg homolog 1;
Name=SCMH1 {ECO:0000312|EMBL:CAH72793.1};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1] {ECO:0000305, ECO:0000312|EMBL:AAF01150.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), AND TISSUE SPECIFICITY.
TISSUE=Heart {ECO:0000312|EMBL:AAF01150.1}, and
Skeletal muscle {ECO:0000269|PubMed:10524249};
PubMed=10524249; DOI=10.1016/S0378-1119(99)00285-1;
Berger J., Kurahashi H., Takihara Y., Shimada K., Brock H.W.,
Randazzo F.;
"The human homolog of Sex comb on midleg (SCMH1) maps to chromosome
1p34.";
Gene 237:185-191(1999).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
TISSUE=Tongue;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3] {ECO:0000305, ECO:0000312|EMBL:CAG33442.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
"Cloning of human full open reading frames in Gateway(TM) system entry
vector (pDONR201).";
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
TISSUE=Fetal brain;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 2).
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6] {ECO:0000305, ECO:0000312|EMBL:AAH21252.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
TISSUE=Eye {ECO:0000312|EMBL:AAH21252.1}, and
Muscle {ECO:0000312|EMBL:AAH09752.1};
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
IDENTIFICATION BY MASS SPECTROMETRY, AND ASSOCIATION WITH A PRC1-LIKE
COMPLEX.
PubMed=12167701; DOI=10.1128/MCB.22.17.6070-6078.2002;
Levine S.S., Weiss A., Erdjument-Bromage H., Shao Z., Tempst P.,
Kingston R.E.;
"The core of the polycomb repressive complex is compositionally and
functionally conserved in flies and humans.";
Mol. Cell. Biol. 22:6070-6078(2002).
-!- FUNCTION: Associates with Polycomb group (PcG) multiprotein
complexes; the complex class is required to maintain the
transcriptionally repressive state of some genes. {ECO:0000250}.
-!- SUBUNIT: Interacts with the SAM domain of PHC1 via its SAM domain
in vitro (By similarity). Associates with a PRC1-like complex.
{ECO:0000250}.
-!- INTERACTION:
P43365:MAGEA12; NbExp=3; IntAct=EBI-713793, EBI-749530;
Q9UMX0:UBQLN1; NbExp=3; IntAct=EBI-713793, EBI-741480;
Q9UMX0-2:UBQLN1; NbExp=3; IntAct=EBI-713793, EBI-10173939;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=1;
IsoId=Q96GD3-1; Sequence=Displayed;
Note=No experimental confirmation available. {ECO:0000305};
Name=2;
IsoId=Q96GD3-2; Sequence=VSP_051676, VSP_051679;
Note=Gene prediction confirmed by EST data.;
Name=3;
IsoId=Q96GD3-3; Sequence=VSP_051678;
Name=4 {ECO:0000269|PubMed:10524249};
IsoId=Q96GD3-4; Sequence=VSP_051677, VSP_051679;
Name=5 {ECO:0000269|PubMed:10524249};
IsoId=Q96GD3-5; Sequence=VSP_051678, VSP_051679;
Note=May be due to intron retention.
{ECO:0000303|PubMed:10524249};
Name=6;
IsoId=Q96GD3-6; Sequence=VSP_051677, VSP_043395, VSP_051679;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Strongly expressed in heart, muscle and
pancreas. Weakly expressed in brain, placenta, lung, liver and
kidney. {ECO:0000269|PubMed:10524249}.
-!- SIMILARITY: Belongs to the SCM family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF149045; AAF01150.1; -; mRNA.
EMBL; AF149046; AAF01151.1; -; mRNA.
EMBL; AK299383; BAG61370.1; -; mRNA.
EMBL; CR457161; CAG33442.1; -; mRNA.
EMBL; BX640721; CAE45840.1; -; mRNA.
EMBL; AL110502; CAI22109.1; -; Genomic_DNA.
EMBL; AL391730; CAI22109.1; JOINED; Genomic_DNA.
EMBL; AL110502; CAI22110.1; -; Genomic_DNA.
EMBL; AL391730; CAI22110.1; JOINED; Genomic_DNA.
EMBL; AL110502; CAI22111.1; -; Genomic_DNA.
EMBL; AL391730; CAI22111.1; JOINED; Genomic_DNA.
EMBL; AL606484; CAI22111.1; JOINED; Genomic_DNA.
EMBL; AL110502; CAI22112.1; -; Genomic_DNA.
EMBL; AL391730; CAI22112.1; JOINED; Genomic_DNA.
EMBL; AL110502; CAI22113.1; -; Genomic_DNA.
EMBL; AL391730; CAI22113.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72791.1; -; Genomic_DNA.
EMBL; AL110502; CAH72791.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72793.1; -; Genomic_DNA.
EMBL; AL110502; CAH72793.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72794.1; -; Genomic_DNA.
EMBL; AL110502; CAH72794.1; JOINED; Genomic_DNA.
EMBL; AL606484; CAH72794.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72795.1; -; Genomic_DNA.
EMBL; AL110502; CAH72795.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72796.1; -; Genomic_DNA.
EMBL; AL110502; CAH72796.1; JOINED; Genomic_DNA.
EMBL; AL606484; CAH72242.1; -; Genomic_DNA.
EMBL; AL110502; CAH72242.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72242.1; JOINED; Genomic_DNA.
EMBL; BC009752; AAH09752.1; -; mRNA.
EMBL; BC021252; AAH21252.1; -; mRNA.
CCDS; CCDS30688.1; -. [Q96GD3-1]
CCDS; CCDS461.1; -. [Q96GD3-4]
CCDS; CCDS53301.1; -. [Q96GD3-5]
CCDS; CCDS53302.1; -. [Q96GD3-3]
CCDS; CCDS53303.1; -. [Q96GD3-6]
CCDS; CCDS53304.1; -. [Q96GD3-2]
RefSeq; NP_001026864.1; NM_001031694.2. [Q96GD3-1]
RefSeq; NP_001165689.1; NM_001172218.1. [Q96GD3-5]
RefSeq; NP_001165690.1; NM_001172219.1. [Q96GD3-2]
RefSeq; NP_001165691.1; NM_001172220.1. [Q96GD3-5]
RefSeq; NP_001165692.1; NM_001172221.1. [Q96GD3-3]
RefSeq; NP_001165693.1; NM_001172222.2. [Q96GD3-6]
RefSeq; NP_036368.1; NM_012236.3. [Q96GD3-4]
RefSeq; XP_006710527.1; XM_006710464.1. [Q96GD3-3]
RefSeq; XP_011539335.1; XM_011541033.2. [Q96GD3-1]
RefSeq; XP_011539338.1; XM_011541036.2. [Q96GD3-3]
RefSeq; XP_016856188.1; XM_017000699.1. [Q96GD3-3]
RefSeq; XP_016856196.1; XM_017000707.1.
UniGene; Hs.571874; -.
PDB; 2P0K; X-ray; 1.75 A; A=27-238.
PDBsum; 2P0K; -.
ProteinModelPortal; Q96GD3; -.
SMR; Q96GD3; -.
BioGrid; 116609; 30.
CORUM; Q96GD3; -.
IntAct; Q96GD3; 21.
MINT; Q96GD3; -.
STRING; 9606.ENSP00000318094; -.
DrugBank; DB03345; Beta-Mercaptoethanol.
iPTMnet; Q96GD3; -.
PhosphoSitePlus; Q96GD3; -.
BioMuta; SCMH1; -.
DMDM; 60390956; -.
jPOST; Q96GD3; -.
MaxQB; Q96GD3; -.
PaxDb; Q96GD3; -.
PeptideAtlas; Q96GD3; -.
PRIDE; Q96GD3; -.
ProteomicsDB; 76617; -.
ProteomicsDB; 76618; -. [Q96GD3-2]
ProteomicsDB; 76619; -. [Q96GD3-3]
ProteomicsDB; 76620; -. [Q96GD3-4]
ProteomicsDB; 76621; -. [Q96GD3-5]
ProteomicsDB; 76622; -. [Q96GD3-6]
DNASU; 22955; -.
Ensembl; ENST00000326197; ENSP00000318094; ENSG00000010803. [Q96GD3-1]
Ensembl; ENST00000337495; ENSP00000337352; ENSG00000010803. [Q96GD3-2]
Ensembl; ENST00000361191; ENSP00000354656; ENSG00000010803. [Q96GD3-5]
Ensembl; ENST00000361705; ENSP00000354996; ENSG00000010803. [Q96GD3-4]
Ensembl; ENST00000372595; ENSP00000361676; ENSG00000010803. [Q96GD3-3]
Ensembl; ENST00000372596; ENSP00000361677; ENSG00000010803. [Q96GD3-5]
Ensembl; ENST00000372597; ENSP00000361678; ENSG00000010803. [Q96GD3-4]
Ensembl; ENST00000397171; ENSP00000380356; ENSG00000010803. [Q96GD3-5]
Ensembl; ENST00000397174; ENSP00000380359; ENSG00000010803. [Q96GD3-1]
Ensembl; ENST00000402904; ENSP00000386079; ENSG00000010803. [Q96GD3-3]
Ensembl; ENST00000456518; ENSP00000403974; ENSG00000010803. [Q96GD3-6]
GeneID; 22955; -.
KEGG; hsa:22955; -.
UCSC; uc001cgp.4; human. [Q96GD3-1]
CTD; 22955; -.
EuPathDB; HostDB:ENSG00000010803.16; -.
GeneCards; SCMH1; -.
HGNC; HGNC:19003; SCMH1.
HPA; HPA048898; -.
HPA; HPA053292; -.
MIM; 616396; gene.
neXtProt; NX_Q96GD3; -.
OpenTargets; ENSG00000010803; -.
PharmGKB; PA134870272; -.
eggNOG; ENOG410IMEZ; Eukaryota.
eggNOG; ENOG410XPKI; LUCA.
GeneTree; ENSGT00940000157999; -.
HOGENOM; HOG000236280; -.
HOVERGEN; HBG056406; -.
InParanoid; Q96GD3; -.
KO; K11461; -.
OMA; KILNNAM; -.
OrthoDB; 229086at2759; -.
PhylomeDB; Q96GD3; -.
TreeFam; TF106488; -.
Reactome; R-HSA-2559580; Oxidative Stress Induced Senescence.
Reactome; R-HSA-3108214; SUMOylation of DNA damage response and repair proteins.
Reactome; R-HSA-3899300; SUMOylation of transcription cofactors.
Reactome; R-HSA-4551638; SUMOylation of chromatin organization proteins.
Reactome; R-HSA-4570464; SUMOylation of RNA binding proteins.
Reactome; R-HSA-4655427; SUMOylation of DNA methylation proteins.
Reactome; R-HSA-8939243; RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known.
Reactome; R-HSA-8943724; Regulation of PTEN gene transcription.
ChiTaRS; SCMH1; human.
EvolutionaryTrace; Q96GD3; -.
GeneWiki; SCMH1; -.
GenomeRNAi; 22955; -.
PRO; PR:Q96GD3; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000010803; Expressed in 205 organ(s), highest expression level in esophagogastric junction muscularis propria.
ExpressionAtlas; Q96GD3; baseline and differential.
Genevisible; Q96GD3; HS.
GO; GO:0010369; C:chromocenter; IEA:Ensembl.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0009952; P:anterior/posterior pattern specification; IEA:Ensembl.
GO; GO:0006338; P:chromatin remodeling; IEA:Ensembl.
GO; GO:0016458; P:gene silencing; ISS:UniProtKB.
GO; GO:0045892; P:negative regulation of transcription, DNA-templated; NAS:UniProtKB.
GO; GO:0007283; P:spermatogenesis; IEA:Ensembl.
Gene3D; 1.20.1380.20; -; 1.
InterPro; IPR004092; Mbt.
InterPro; IPR001660; SAM.
InterPro; IPR013761; SAM/pointed_sf.
InterPro; IPR033763; SCML2_RBR.
InterPro; IPR021987; SLED.
InterPro; IPR038348; SLED_sf.
Pfam; PF02820; MBT; 2.
Pfam; PF17208; RBR; 1.
Pfam; PF00536; SAM_1; 1.
Pfam; PF12140; SLED; 1.
SMART; SM00561; MBT; 2.
SMART; SM00454; SAM; 1.
SUPFAM; SSF47769; SSF47769; 1.
PROSITE; PS51079; MBT; 2.
PROSITE; PS50105; SAM_DOMAIN; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome;
Developmental protein; Nucleus; Reference proteome; Repeat; Repressor;
Transcription; Transcription regulation.
CHAIN 1 660 Polycomb protein SCMH1.
/FTId=PRO_0000114334.
REPEAT 28 126 MBT 1.
REPEAT 134 235 MBT 2.
DOMAIN 593 658 SAM. {ECO:0000255|PROSITE-
ProRule:PRU00184}.
VAR_SEQ 1 61 Missing (in isoform 3 and isoform 5).
{ECO:0000303|PubMed:10524249,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:17974005,
ECO:0000303|Ref.3}.
/FTId=VSP_051678.
VAR_SEQ 1 48 MLVCYSVLACEILWDLPCSIMGSPLGHFTWDKYLKETCSVP
APVHCFK -> M (in isoform 4 and isoform
6). {ECO:0000303|PubMed:10524249,
ECO:0000303|PubMed:14702039}.
/FTId=VSP_051677.
VAR_SEQ 1 24 MLVCYSVLACEILWDLPCSIMGSP -> MQPNVIDWSDVRK
HKYGHLSESASQYQEAADILD (in isoform 2).
{ECO:0000305}.
/FTId=VSP_051676.
VAR_SEQ 128 238 Missing (in isoform 6).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_043395.
VAR_SEQ 550 571 Missing (in isoform 2, isoform 4, isoform
5 and isoform 6).
{ECO:0000303|PubMed:10524249,
ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:17974005}.
/FTId=VSP_051679.
CONFLICT 463 463 F -> L (in Ref. 3). {ECO:0000305}.
HELIX 30 36 {ECO:0000244|PDB:2P0K}.
HELIX 44 46 {ECO:0000244|PDB:2P0K}.
STRAND 47 49 {ECO:0000244|PDB:2P0K}.
STRAND 63 68 {ECO:0000244|PDB:2P0K}.
STRAND 71 84 {ECO:0000244|PDB:2P0K}.
STRAND 87 92 {ECO:0000244|PDB:2P0K}.
STRAND 101 104 {ECO:0000244|PDB:2P0K}.
HELIX 115 118 {ECO:0000244|PDB:2P0K}.
HELIX 133 135 {ECO:0000244|PDB:2P0K}.
HELIX 136 144 {ECO:0000244|PDB:2P0K}.
HELIX 152 154 {ECO:0000244|PDB:2P0K}.
STRAND 172 176 {ECO:0000244|PDB:2P0K}.
STRAND 184 193 {ECO:0000244|PDB:2P0K}.
STRAND 196 201 {ECO:0000244|PDB:2P0K}.
TURN 205 208 {ECO:0000244|PDB:2P0K}.
STRAND 210 213 {ECO:0000244|PDB:2P0K}.
HELIX 224 228 {ECO:0000244|PDB:2P0K}.
SEQUENCE 660 AA; 73354 MW; 6544DD484DA8D037 CRC64;
MLVCYSVLAC EILWDLPCSI MGSPLGHFTW DKYLKETCSV PAPVHCFKQS YTPPSNEFKI
SMKLEAQDPR NTTSTCIATV VGLTGARLRL RLDGSDNKND FWRLVDSAEI QPIGNCEKNG
GMLQPPLGFR LNASSWPMFL LKTLNGAEMA PIRIFHKEPP SPSHNFFKMG MKLEAVDRKN
PHFICPATIG EVRGSEVLVT FDGWRGAFDY WCRFDSRDIF PVGWCSLTGD NLQPPGTKVV
IPKNPYPASD VNTEKPSIHS STKTVLEHQP GQRGRKPGKK RGRTPKTLIS HPISAPSKTA
EPLKFPKKRG PKPGSKRKPR TLLNPPPASP TTSTPEPDTS TVPQDAATIP SSAMQAPTVC
IYLNKNGSTG PHLDKKKVQQ LPDHFGPARA SVVLQQAVQA CIDCAYHQKT VFSFLKQGHG
GEVISAVFDR EQHTLNLPAV NSITYVLRFL EKLCHNLRSD NLFGNQPFTQ THLSLTAIEY
SHSHDRYLPG ETFVLGNSLA RSLEPHSDSM DSASNPTNLV STSQRHRPLL SSCGLPPSTA
SAVRRLCSRG VLKGSNERRD MESFWKLNRS PGSDRYLESR DASRLSGRDP SSWTVEDVMQ
FVREADPQLG PHADLFRKHE IDGKALLLLR SDMMMKYMGL KLGPALKLSY HIDRLKQGKF


Related products :

Catalog number Product name Quantity
EIAAB37569 Mouse,Mus musculus,Polycomb protein SCMH1,Scmh1,Sex comb on midleg homolog 1
EIAAB37570 Homo sapiens,Human,Polycomb protein SCMH1,SCMH1,Sex comb on midleg homolog 1
SCMH1 SCMH1 Gene sex comb on midleg homolog 1 (Drosophila)
201-20-5130 SCMH1{sex comb on midleg homolog 1 (Drosophila)}rabbit.pAb 0.2ml
CSB-EL020828MO Mouse sex comb on midleg homolog 1 (Drosophila) (SCMH1) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL020828HU Human sex comb on midleg homolog 1 (Drosophila) (SCMH1) ELISA kit, Species Human, Sample Type serum, plasma 96T
SCMH1_MOUSE ELISA Kit FOR Polycomb protein SCMH1; organism: Mouse; gene name: Scmh1 96T
CSB-EL020828HU Human Polycomb protein SCMH1(SCMH1) ELISA kit SpeciesHuman 96T
CSB-EL020828MO Mouse Polycomb protein SCMH1(SCMH1) ELISA kit SpeciesMouse 96T
CSB-EL020828HU Human Polycomb protein SCMH1(SCMH1) ELISA kit 96T
CSB-EL020828MO Mouse Polycomb protein SCMH1(SCMH1) ELISA kit 96T
20-372-60106 sex comb on midleg-like 2 (Drosophila) (SCML2). mRNA - Mouse monoclonal anti-human SCML2 antibody; Drosophila; Sex comb on midleg-like 2 (Drosophila). isoform CRA_a Monoclonal 0.1 mg
E5547h Human Sex Comb On Midleg Like Protein 1 ELISA Kit 96T
E5546h Human Sex Comb On Midleg Like Protein 2 ELISA Kit 96T
CA180_HUMAN Mouse ELISA Kit FOR Sex comb on midleg-like protein 4 96T
E0295Rb Mouse ELISA Kit FOR Sex comb on midleg-like protein 4 96T
U2D2L_HUMAN Human ELISA Kit FOR Sex comb on midleg-like protein 2 96T
CN038_HUMAN Human ELISA Kit FOR Sex comb on midleg-like protein 2 96T
E8002h Human Sex Comb On Midleg Like Protein 3 ELISA Kit 96T
E0052m Human ELISA Kit FOR Sex comb on midleg-like protein 2 96T
NIT2_RAT Mouse ELISA Kit FOR Sex comb on midleg-like protein 4 96T
E6675h Human Sex Comb On Midleg Like Protein 4 ELISA Kit 96T
CSB-EL020831MO Mouse Sex comb on midleg-like protein 4(SCML4) ELISA kit 96T
CSB-EL020831HU Human Sex comb on midleg-like protein 4(SCML4) ELISA kit 96T
CSB-EL020829HU Human Sex comb on midleg-like protein 1(SCML1) ELISA kit 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1049: G Protein Signaling Pathways
WP1165: G Protein Signaling Pathways
WP1371: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1493: Carbon assimilation C4 pathway
WP1502: Mitochondrial biogenesis
WP1531: Vitamin D synthesis
WP1566: Citrate cycle (TCA cycle)
WP1613: 1,4-Dichlorobenzene degradation
WP1616: ABC transporters
WP1624: Bacterial secretion system
WP1625: Base excision repair
WP1644: DNA replication
WP1650: Fluorobenzoate degradation
WP1654: gamma-Hexachlorocyclohexane degradation
WP1657: Glycerolipid metabolism
WP1659: Glycine, serine and threonine metabolism
WP1661: Glyoxylate and dicarboxylate metabolism
WP1663: Homologous recombination
WP1665: Limonene and pinene degradation
WP1672: Mismatch repair
WP1673: Naphthalene and anthracene degradation
WP1675: Nitrogen metabolism
WP1676: Non-homologous end-joining
WP1678: Nucleotide excision repair

Related Genes :
[Spata24 Tipt Tipt2] Spermatogenesis-associated protein 24 (TATA-binding protein-like factor-interacting protein) (TLF-interacting protein) (TRF2-interacting protein in testis) (Testis protein T6441 homolog)
[UBQLN1 DA41 PLIC1] Ubiquilin-1 (Protein linking IAP with cytoskeleton 1) (PLIC-1) (hPLIC-1)
[SPATA24] Spermatogenesis-associated protein 24 (Testis protein T6441 homolog)
[ASXL1 KIAA0978] Putative Polycomb group protein ASXL1 (Additional sex combs-like protein 1)
[MAGEA12 MAGE12] Melanoma-associated antigen 12 (Cancer/testis antigen 1.12) (CT1.12) (MAGE-12 antigen) (MAGE12F antigen)
[Asxl1 Kiaa0978] Putative Polycomb group protein ASXL1 (Additional sex combs-like protein 1)
[Asx CG8787] Polycomb protein Asx (Additional sex combs)
[SUZ12 CHET9 JJAZ1 KIAA0160] Polycomb protein SUZ12 (Chromatin precipitated E2F target 9 protein) (ChET 9 protein) (Joined to JAZF1 protein) (Suppressor of zeste 12 protein homolog)
[ASXL2 ASXH2 KIAA1685] Putative Polycomb group protein ASXL2 (Additional sex combs-like protein 2)
[Spata24] Spermatogenesis-associated protein 24 (Testis protein T6441)
[EED] Polycomb protein EED (hEED) (Embryonic ectoderm development protein) (WD protein associating with integrin cytoplasmic tails 1) (WAIT-1)
[CBX2] Chromobox protein homolog 2
[KMT2B HRX2 KIAA0304 MLL2 MLL4 TRX2 WBP7] Histone-lysine N-methyltransferase 2B (Lysine N-methyltransferase 2B) (EC 2.1.1.43) (Myeloid/lymphoid or mixed-lineage leukemia protein 4) (Trithorax homolog 2) (WW domain-binding protein 7) (WBP-7)
[DNAJC2 MPHOSPH11 MPP11 ZRF1] DnaJ homolog subfamily C member 2 (M-phase phosphoprotein 11) (Zuotin-related factor 1) [Cleaved into: DnaJ homolog subfamily C member 2, N-terminally processed]
[CLF ICU1 PIF1 PIF2 SDG1 SET1 At2g23380 F26B6.3] Histone-lysine N-methyltransferase CLF (EC 2.1.1.43) (Polycomb group protein CURLY LEAF) (Protein INCURVATA 1) (Protein SET DOMAIN GROUP 1) (Protein photoperiod insensitive flowering)
[ph-p CG18412] Polyhomeotic-proximal chromatin protein
[SPATA24 QtsA-15191] Spermatogenesis-associated protein 24 (Testis protein T6441 homolog)
[EZH2 KMT6] Histone-lysine N-methyltransferase EZH2 (EC 2.1.1.43) (ENX-1) (Enhancer of zeste homolog 2) (Lysine N-methyltransferase 6)
[Pcgf2 Mel-18 Mel18 Rnf110 Zfp144 Znf144] Polycomb group RING finger protein 2 (DNA-binding protein Mel-18) (Melanoma nuclear protein 18) (RING finger protein 110) (Zinc finger protein 144) (Zfp-144)
[DNAJA1 DNAJ2 HDJ2 HSJ2 HSPF4] DnaJ homolog subfamily A member 1 (DnaJ protein homolog 2) (HSDJ) (Heat shock 40 kDa protein 4) (Heat shock protein J2) (HSJ-2) (Human DnaJ protein 2) (hDj-2)
[Cbx2 M33] Chromobox protein homolog 2 (M33) (Modifier 3 protein)
[Ezh2 Enx1h] Histone-lysine N-methyltransferase EZH2 (EC 2.1.1.43) (ENX-1) (Enhancer of zeste homolog 2)
[PHF19 PCL3] PHD finger protein 19 (Polycomb-like protein 3) (hPCL3)
[NTG1 OGG2 SCR1 YAL015C FUN33] Endonuclease III homolog 1 (EC 3.2.2.-) (EC 4.2.99.18) (Bifunctional DNA N-glycosylase/DNA-(apurinic or apyrimidinic site) lyase 1) (DNA glycosylase/AP lyase 1) (Endonuclease III-like glycosylase 1) (Redoxyendonuclease 1)
[EMF2 At5g51230/At5g51240 MWD22.18/MWD22.19] Polycomb group protein EMBRYONIC FLOWER 2
[fem-2 T19C3.8] Protein phosphatase fem-2 (EC 3.1.3.16) (Ca(2+)/calmodulin-dependent protein kinase phosphatase) (CaM-kinase phosphatase) (CaMKPase) (Feminization of XX and XO animals protein 2) (Sex-determining protein fem-2)
[BMI1 BMI-1 PCGF4] Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4)
[KMT2A ALL1 CXXC7 HRX HTRX MLL MLL1 TRX1] Histone-lysine N-methyltransferase 2A (Lysine N-methyltransferase 2A) (EC 2.1.1.43) (ALL-1) (CXXC-type zinc finger protein 7) (Myeloid/lymphoid or mixed-lineage leukemia) (Myeloid/lymphoid or mixed-lineage leukemia protein 1) (Trithorax-like protein) (Zinc finger protein HRX) [Cleaved into: MLL cleavage product N320 (N-terminal cleavage product of 320 kDa) (p320); MLL cleavage product C180 (C-terminal cleavage product of 180 kDa) (p180)]
[PHF1 PCL1] PHD finger protein 1 (Protein PHF1) (hPHF1) (Polycomb-like protein 1) (hPCl1)
[Cbx7 D15Ertd417e] Chromobox protein homolog 7

Bibliography :
[17215307] Mammalian Polycomb Scmh1 mediates exclusion of Polycomb complexes from the XY body in the pachytene spermatocytes.
[10653359] A novel member of murine Polycomb-group proteins, Sex comb on midleg homolog protein, is highly conserved, and interacts with RAE28/mph1 in vitro.
[10524249] The human homolog of Sex comb on midleg (SCMH1) maps to chromosome 1p34.
?>