GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Potassium voltage-gated channel subfamily C member 1 (NGK2) (Voltage-gated potassium channel subunit Kv3.1) (Voltage-gated potassium channel subunit Kv4)

 KCNC1_HUMAN             Reviewed;         511 AA.
P48547; K4DI87;
01-FEB-1996, integrated into UniProtKB/Swiss-Prot.
01-FEB-1996, sequence version 1.
29-SEP-2021, entry version 187.
RecName: Full=Potassium voltage-gated channel subfamily C member 1;
AltName: Full=NGK2;
AltName: Full=Voltage-gated potassium channel subunit Kv3.1;
AltName: Full=Voltage-gated potassium channel subunit Kv4;
Name=KCNC1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=8449507; DOI=10.1006/geno.1993.1075;
Ried T., Rudy B., de Miera E., Lau D., Ward D.C., Sen K.;
"Localization of a highly conserved human potassium channel gene (NGK2-KV4;
KCNC1) to chromosome 11p15.";
Genomics 15:405-411(1993).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16554811; DOI=10.1038/nature04632;
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K.,
Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T.,
Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G.,
Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C.,
Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A.,
Hattori M., Rogers J., Lander E.S., Sakaki Y.;
"Human chromosome 11 DNA sequence and analysis including novel gene
identification.";
Nature 440:497-500(2006).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [MRNA] OF 244-475 (ISOFORM 1).
PubMed=1400413;
Grissmer S., Ghanshani S., Dethlefs B., McPherson J.D., Wasmuth J.J.,
Gutman G.A., Cahalan M.D., Chandy K.G.;
"The Shaw-related potassium channel gene, Kv3.1, on human chromosome 11,
encodes the type l K+ channel in T cells.";
J. Biol. Chem. 267:20971-20979(1992).
[5]
INTERACTION WITH KCNC3.
PubMed=23734863; DOI=10.1042/bj20130034;
Zhao J., Zhu J., Thornhill W.B.;
"Spinocerebellar ataxia-13 Kv3.3 potassium channels: arginine-to-histidine
mutations affect both functional and protein expression on the cell
surface.";
Biochem. J. 454:259-265(2013).
[6]
INVOLVEMENT IN EPM7, VARIANT EPM7 HIS-320, CHARACTERIZATION OF VARIANT EPM7
HIS-320, FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=25401298; DOI=10.1038/ng.3144;
Muona M., Berkovic S.F., Dibbens L.M., Oliver K.L., Maljevic S.,
Bayly M.A., Joensuu T., Canafoglia L., Franceschetti S., Michelucci R.,
Markkinen S., Heron S.E., Hildebrand M.S., Andermann E., Andermann F.,
Gambardella A., Tinuper P., Licchetta L., Scheffer I.E., Criscuolo C.,
Filla A., Ferlazzo E., Ahmad J., Ahmad A., Baykan B., Said E., Topcu M.,
Riguzzi P., King M.D., Ozkara C., Andrade D.M., Engelsen B.A., Crespel A.,
Lindenau M., Lohmann E., Saletti V., Massano J., Privitera M., Espay A.J.,
Kauffmann B., Duchowny M., Moeller R.S., Straussberg R., Afawi Z.,
Ben-Zeev B., Samocha K.E., Daly M.J., Petrou S., Lerche H., Palotie A.,
Lehesjoki A.E.;
"A recurrent de novo mutation in KCNC1 causes progressive myoclonus
epilepsy.";
Nat. Genet. 47:39-46(2015).
-!- FUNCTION: Voltage-gated potassium channel that plays an important role
in the rapid repolarization of fast-firing brain neurons. The channel
opens in response to the voltage difference across the membrane,
forming a potassium-selective channel through which potassium ions pass
in accordance with their electrochemical gradient (PubMed:25401298).
Can form functional homotetrameric channels and heterotetrameric
channels that contain variable proportions of KCNC2, and possibly other
family members as well. Contributes to fire sustained trains of very
brief action potentials at high frequency in pallidal neurons.
{ECO:0000250|UniProtKB:P25122, ECO:0000269|PubMed:25401298}.
-!- SUBUNIT: Heteromultimer with KCNG3, KCNG4 and KCNV2 (By similarity).
Heteromultimer with KCNC2 (By similarity). Heterotetramer with KCNC3
(PubMed:23734863). Interacts with the ancillary subunits KCNE1 and
KCNE2; the interaction modulates channel activity (By similarity).
{ECO:0000250, ECO:0000250|UniProtKB:P25122,
ECO:0000269|PubMed:23734863}.
-!- INTERACTION:
P48547; Q9UBY5: LPAR3; NbExp=3; IntAct=EBI-12830942, EBI-12033434;
P48547; P55061: TMBIM6; NbExp=3; IntAct=EBI-12830942, EBI-1045825;
P48547; A5PKU2: TUSC5; NbExp=3; IntAct=EBI-12830942, EBI-11988865;
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:25401298};
Multi-pass membrane protein {ECO:0000255}. Cell projection, axon
{ECO:0000250|UniProtKB:P25122}. Cell junction, synapse, presynaptic
cell membrane {ECO:0000250|UniProtKB:P25122}. Note=Localizes in
parallel fiber membranes, distributed on the perisynaptic and
extrasynaptic membranes away from the active zones.
{ECO:0000250|UniProtKB:P25122}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P48547-1; Sequence=Displayed;
Name=2;
IsoId=P48547-2; Sequence=VSP_055129;
-!- DOMAIN: The segment S4 is probably the voltage-sensor and is
characterized by a series of positively charged amino acids at every
third position. {ECO:0000305}.
-!- DOMAIN: The tail may be important in modulation of channel activity
and/or targeting of the channel to specific subcellular compartments.
{ECO:0000305}.
-!- PTM: N-glycosylated; contains sialylated glycans.
{ECO:0000250|UniProtKB:P25122}.
-!- DISEASE: Epilepsy, progressive myoclonic 7 (EPM7) [MIM:616187]: A form
of progressive myoclonic epilepsy, a clinically and genetically
heterogeneous group of disorders defined by the combination of action
and reflex myoclonus, other types of epileptic seizures, and
progressive neurodegeneration and neurocognitive impairment. EPM7 is an
autosomal dominant form characterized by myoclonic epilepsy apparent in
the first or second decades of life. Cognitive function may decline in
some patients. {ECO:0000269|PubMed:25401298}. Note=The disease is
caused by variants affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the potassium channel family. C (Shaw) (TC
1.A.1.2) subfamily. Kv3.1/KCNC1 sub-subfamily. {ECO:0000305}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; S56770; AAB25764.1; -; mRNA.
EMBL; AC124056; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC124078; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC124301; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471064; EAW68425.1; -; Genomic_DNA.
EMBL; M96747; AAA59458.1; -; mRNA.
CCDS; CCDS44547.1; -. [P48547-2]
CCDS; CCDS7827.1; -. [P48547-1]
PIR; A46020; A46020.
RefSeq; NP_001106212.1; NM_001112741.1. [P48547-2]
RefSeq; NP_004967.1; NM_004976.4. [P48547-1]
SMR; P48547; -.
BioGRID; 109948; 11.
IntAct; P48547; 4.
STRING; 9606.ENSP00000265969; -.
BindingDB; P48547; -.
ChEMBL; CHEMBL5529; -.
DrugBank; DB06637; Dalfampridine.
DrugBank; DB00228; Enflurane.
DrugBank; DB01110; Miconazole.
DrugBank; DB01069; Promethazine.
DrugCentral; P48547; -.
TCDB; 1.A.1.2.24; the voltage-gated ion channel (vic) superfamily.
GlyGen; P48547; 2 sites.
iPTMnet; P48547; -.
PhosphoSitePlus; P48547; -.
BioMuta; KCNC1; -.
DMDM; 1352085; -.
MassIVE; P48547; -.
PaxDb; P48547; -.
PeptideAtlas; P48547; -.
PRIDE; P48547; -.
ProteomicsDB; 55903; -. [P48547-1]
Antibodypedia; 24953; 419 antibodies.
DNASU; 3746; -.
Ensembl; ENST00000265969; ENSP00000265969; ENSG00000129159. [P48547-2]
Ensembl; ENST00000379472; ENSP00000368785; ENSG00000129159. [P48547-1]
Ensembl; ENST00000640909; ENSP00000491644; ENSG00000129159. [P48547-2]
GeneID; 3746; -.
KEGG; hsa:3746; -.
UCSC; uc001mnk.5; human. [P48547-1]
CTD; 3746; -.
DisGeNET; 3746; -.
GeneCards; KCNC1; -.
HGNC; HGNC:6233; KCNC1.
HPA; ENSG00000129159; Tissue enriched (brain).
MalaCards; KCNC1; -.
MIM; 176258; gene.
MIM; 616187; phenotype.
neXtProt; NX_P48547; -.
OpenTargets; ENSG00000129159; -.
Orphanet; 435438; Progressive myoclonic epilepsy type 7.
PharmGKB; PA30026; -.
VEuPathDB; HostDB:ENSG00000129159; -.
eggNOG; KOG3713; Eukaryota.
GeneTree; ENSGT00940000156912; -.
HOGENOM; CLU_011722_4_3_1; -.
InParanoid; P48547; -.
OMA; PNFCKSG; -.
OrthoDB; 818306at2759; -.
PhylomeDB; P48547; -.
TreeFam; TF352511; -.
PathwayCommons; P48547; -.
Reactome; R-HSA-1296072; Voltage gated Potassium channels.
BioGRID-ORCS; 3746; 18 hits in 1002 CRISPR screens.
GenomeRNAi; 3746; -.
Pharos; P48547; Tclin.
PRO; PR:P48547; -.
Proteomes; UP000005640; Chromosome 11.
RNAct; P48547; protein.
Bgee; ENSG00000129159; Expressed in cerebellar cortex and 121 other tissues.
ExpressionAtlas; P48547; baseline and differential.
Genevisible; P48547; HS.
GO; GO:0030673; C:axolemma; IEA:Ensembl.
GO; GO:0030424; C:axon; IBA:GO_Central.
GO; GO:0044305; C:calyx of Held; IEA:Ensembl.
GO; GO:0009986; C:cell surface; IEA:Ensembl.
GO; GO:0032590; C:dendrite membrane; IBA:GO_Central.
GO; GO:0016021; C:integral component of membrane; IBA:GO_Central.
GO; GO:0099055; C:integral component of postsynaptic membrane; IEA:Ensembl.
GO; GO:0099056; C:integral component of presynaptic membrane; IEA:Ensembl.
GO; GO:0032809; C:neuronal cell body membrane; ISS:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0008076; C:voltage-gated potassium channel complex; IDA:UniProtKB.
GO; GO:0005251; F:delayed rectifier potassium channel activity; ISS:UniProtKB.
GO; GO:0019894; F:kinesin binding; IEA:Ensembl.
GO; GO:0044325; F:transmembrane transporter binding; IEA:Ensembl.
GO; GO:0099508; F:voltage-gated ion channel activity involved in regulation of presynaptic membrane potential; IEA:Ensembl.
GO; GO:0005249; F:voltage-gated potassium channel activity; IBA:GO_Central.
GO; GO:0035690; P:cellular response to drug; IEA:Ensembl.
GO; GO:0021549; P:cerebellum development; IEA:Ensembl.
GO; GO:0021759; P:globus pallidus development; IEA:Ensembl.
GO; GO:1903818; P:positive regulation of voltage-gated potassium channel activity; IEA:Ensembl.
GO; GO:0071805; P:potassium ion transmembrane transport; ISS:UniProtKB.
GO; GO:0006813; P:potassium ion transport; TAS:ProtInc.
GO; GO:0051260; P:protein homooligomerization; IEA:InterPro.
GO; GO:0051262; P:protein tetramerization; IDA:UniProtKB.
GO; GO:0014075; P:response to amine; IEA:Ensembl.
GO; GO:0010996; P:response to auditory stimulus; IEA:Ensembl.
GO; GO:0071774; P:response to fibroblast growth factor; IEA:Ensembl.
GO; GO:0009642; P:response to light intensity; IEA:Ensembl.
GO; GO:1990089; P:response to nerve growth factor; IEA:Ensembl.
GO; GO:0035864; P:response to potassium ion; IEA:Ensembl.
GO; GO:0009636; P:response to toxic substance; IEA:Ensembl.
Gene3D; 1.20.120.350; -; 1.
Gene3D; 3.30.710.10; -; 1.
InterPro; IPR000210; BTB/POZ_dom.
InterPro; IPR005821; Ion_trans_dom.
InterPro; IPR003968; K_chnl_volt-dep_Kv.
InterPro; IPR003974; K_chnl_volt-dep_Kv3.
InterPro; IPR005403; K_chnl_volt-dep_Kv3.1.
InterPro; IPR011333; SKP1/BTB/POZ_sf.
InterPro; IPR003131; T1-type_BTB.
InterPro; IPR028325; VG_K_chnl.
InterPro; IPR027359; Volt_channel_dom_sf.
PANTHER; PTHR11537; PTHR11537; 1.
Pfam; PF02214; BTB_2; 1.
Pfam; PF00520; Ion_trans; 1.
PRINTS; PR01581; KV31CHANNEL.
PRINTS; PR01491; KVCHANNEL.
PRINTS; PR01498; SHAWCHANNEL.
SMART; SM00225; BTB; 1.
SUPFAM; SSF54695; SSF54695; 1.
1: Evidence at protein level;
Alternative splicing; Cell junction; Cell membrane; Cell projection;
Disease variant; Epilepsy; Glycoprotein; Ion channel; Ion transport;
Membrane; Neurodegeneration; Phosphoprotein; Potassium; Potassium channel;
Potassium transport; Reference proteome; Synapse; Transmembrane;
Transmembrane helix; Transport; Voltage-gated channel.
CHAIN 1..511
/note="Potassium voltage-gated channel subfamily C member
1"
/id="PRO_0000054051"
TOPO_DOM 1..190
/note="Cytoplasmic"
/evidence="ECO:0000255"
TRANSMEM 191..209
/note="Helical; Name=Segment S1"
/evidence="ECO:0000255"
TRANSMEM 248..267
/note="Helical; Name=Segment S2"
/evidence="ECO:0000255"
TOPO_DOM 268..276
/note="Cytoplasmic"
/evidence="ECO:0000255"
TRANSMEM 277..295
/note="Helical; Name=Segment S3"
/evidence="ECO:0000255"
TRANSMEM 309..331
/note="Helical; Voltage-sensor; Name=Segment S4"
/evidence="ECO:0000255"
TOPO_DOM 332..344
/note="Cytoplasmic"
/evidence="ECO:0000255"
TRANSMEM 345..366
/note="Helical; Name=Segment S5"
/evidence="ECO:0000255"
TRANSMEM 415..436
/note="Helical; Name=Segment S6"
/evidence="ECO:0000255"
TOPO_DOM 437..511
/note="Cytoplasmic"
/evidence="ECO:0000255"
REGION 121..147
/note="Disordered"
/evidence="ECO:0000256|SAM:MobiDB-lite"
MOTIF 400..405
/note="Selectivity filter"
/evidence="ECO:0000250"
MOD_RES 44
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P25122"
MOD_RES 130
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P25122"
MOD_RES 142
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P25122"
MOD_RES 158
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P25122"
MOD_RES 160
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P15388"
MOD_RES 474
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P15388"
MOD_RES 483
/note="Phosphothreonine"
/evidence="ECO:0000250|UniProtKB:P15388"
CARBOHYD 220
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 229
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
VAR_SEQ 502..511
/note="GRKPLRGMSI -> DSKLNGEVAKAALANEDCPHIDQALTPDEGLPFTRSGT
RERYGPCFLLSTGEYACPPGGGMRKDLCKESPVIAKYMPTEAVRVT (in isoform
2)"
/evidence="ECO:0000305"
/id="VSP_055129"
VARIANT 320
/note="R -> H (in EPM7; causes a dominant-negative loss of
current upon membrane depolarization; dbSNP:rs727502818)"
/evidence="ECO:0000269|PubMed:25401298"
/id="VAR_072705"
SEQUENCE 511 AA; 57942 MW; 10A93478F7120ABB CRC64;
MGQGDESERI VINVGGTRHQ TYRSTLRTLP GTRLAWLAEP DAHSHFDYDP RADEFFFDRH
PGVFAHILNY YRTGKLHCPA DVCGPLYEEE LAFWGIDETD VEPCCWMTYR QHRDAEEALD
SFGGAPLDNS ADDADADGPG DSGDGEDELE MTKRLALSDS PDGRPGGFWR RWQPRIWALF
EDPYSSRYAR YVAFASLFFI LVSITTFCLE THERFNPIVN KTEIENVRNG TQVRYYREAE
TEAFLTYIEG VCVVWFTFEF LMRVIFCPNK VEFIKNSLNI IDFVAILPFY LEVGLSGLSS
KAAKDVLGFL RVVRFVRILR IFKLTRHFVG LRVLGHTLRA STNEFLLLII FLALGVLIFA
TMIYYAERIG AQPNDPSASE HTHFKNIPIG FWWAVVTMTT LGYGDMYPQT WSGMLVGALC
ALAGVLTIAM PVPVIVNNFG MYYSLAMAKQ KLPKKKKKHI PRPPQLGSPN YCKSVVNSPH
HSTQSDTCPL AQEEILEINR AGRKPLRGMS I


Related products :

Catalog number Product name Quantity
18-662-20074 Potassium voltage-gated channel subfamily C member 1 - Voltage-gated potassium channel subunit Kv3.1; Kv4; NGK2; RAW2 Polyclonal 0.1 ml
18-003-42663 Potassium voltage-gated channel subfamily KQT member 2 - Voltage-gated potassium channel subunit Kv7.2; Neuroblastoma-specific potassium channel subunit alpha KvLQT2; KQT-like 2 Polyclonal 0.05 mg Aff Pur
18-003-42664 Potassium voltage-gated channel subfamily KQT member 2 - Voltage-gated potassium channel subunit Kv7.2; Neuroblastoma-specific potassium channel subunit alpha KvLQT2; KQT-like 2 Polyclonal 0.1 mg Protein A
28-297 This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. 0.1 mg
18-662-20009 Potassium voltage-gated channel subfamily B member 2 - Voltage-gated potassium channel subunit Kv2.2; CDRK Polyclonal 0.1 ml
18-003-42629 Potassium voltage-gated channel subfamily D member 3 - Voltage-gated potassium channel subunit Kv4.3 Polyclonal 0.1 mg Protein A
18-003-43133 Potassium voltage-gated channel subfamily G member 1 - Voltage-gated potassium channel subunit Kv6.1; kH2 Polyclonal 0.05 mg Aff Pur
18-003-42631 Cyclic GMP gated potassium channel - Potassium voltage-gated channel. shaker-related subfamily. member 10 Polyclonal 0.1 mg Protein A
EIAAB26323 Four domain-type voltage-gated ion channel alpha-1 subunit,Nalcn,Nca,Rat,Rattus norvegicus,Sodium leak channel non-selective protein,Vgcnl1,Voltage gated channel-like protein 1
18-003-42670 Kv channel-interacting protein 2 - KChIP2; A-type potassium channel modulatory protein 2; Potassium channel-interacting protein 2; Cardiac voltage-gated potassium channel modulatory subunit Polyclonal 0.05 mg Aff Pur
18-003-42669 Kv channel-interacting protein 2 - KChIP2; A-type potassium channel modulatory protein 2; Potassium channel-interacting protein 2; Cardiac voltage-gated potassium channel modulatory subunit Polyclonal 0.05 mg Aff Pur
E1366h Rat ELISA Kit FOR Potassium voltage-gated channel subfamily H member 1 96T
E13768r Rat ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 4 96T
KCNG3_RAT Rat ELISA Kit FOR Potassium voltage-gated channel subfamily G member 3 96T
KCNQ1_PIG Pig ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 1 96T
KCNA5_RAT Rat ELISA Kit FOR Potassium voltage-gated channel subfamily A member 5 96T
WDR64_MOUSE Rat ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 2 96T
E0522m Rat ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 1 96T
E15045p Pig ELISA Kit FOR Potassium voltage-gated channel subfamily H member 2 96T
E0614m Rat ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 2 96T
PPAC_MOUSE Rat ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 1 96T
KCNH4_RAT Rat ELISA Kit FOR Potassium voltage-gated channel subfamily H member 4 96T
KCNH2_RAT Rat ELISA Kit FOR Potassium voltage-gated channel subfamily H member 2 96T
EH2214 Potassium voltage-gated channel subfamily B member 2 Elisa Kit 96T
CSB-EL012023RA Rat Potassium voltage-gated channel subfamily D member 2(KCND2) ELISA kit 96T
Pathways :
WP2197: Endothelin
WP1566: Citrate cycle (TCA cycle)
WP2272: Pathogenic Escherichia coli infection
WP1634: Butanoate metabolism
WP1663: Homologous recombination
WP1680: Oxidative phosphorylation
WP1711: Trinitrotoluene degradation
WP1626: Benzoate degradation via CoA ligation
WP1655: Geraniol degradation
WP1672: Mismatch repair
WP1694: Pyrimidine metabolism
WP2292: Chemokine signaling pathway
WP1614: 1- and 2-Methylnaphthalene degradation
WP1644: DNA replication
WP1671: Methane metabolism
WP1693: Purine metabolism
WP1718: Vitamin B6 metabolism
WP1834: Interactions of the immunoglobulin superfamily (IgSF) member proteins

Related Genes :
[KCNC1] Potassium voltage-gated channel subfamily C member 1 (NGK2) (Voltage-gated potassium channel subunit Kv3.1) (Voltage-gated potassium channel subunit Kv4)
[Kcnc1] Potassium voltage-gated channel subfamily C member 1 (NGK2) (Voltage-gated potassium channel subunit Kv3.1) (Voltage-gated potassium channel subunit Kv4)
[Kcnc1] Potassium voltage-gated channel subfamily C member 1 (NGK2) (RAW2) (Voltage-gated potassium channel subunit Kv3.1) (Voltage-gated potassium channel subunit Kv4)
[Kcnc2] Potassium voltage-gated channel subfamily C member 2 (Potassium channel voltage-gated Shaw-related subfamily C member 2) (Shaw-like potassium channel) (Voltage-gated potassium channel subunit Kv3.2)
[Kcnc3] Potassium voltage-gated channel subfamily C member 3 (KSHIIID) (Voltage-gated potassium channel subunit Kv3.3)
[KCNC4 C1orf30] Potassium voltage-gated channel subfamily C member 4 (KSHIIIC) (Voltage-gated potassium channel subunit Kv3.4)
[Kcnd2 Kiaa1044 MNCb-7013] Potassium voltage-gated channel subfamily D member 2 (Voltage-gated potassium channel subunit Kv4.2)
[Kcnd2] Potassium voltage-gated channel subfamily D member 2 (RK5) (Shal1) (Voltage-gated potassium channel subunit Kv4.2)
[Kcnd3] Potassium voltage-gated channel subfamily D member 3 (Voltage-gated potassium channel subunit Kv4.3)
[KCNC3] Potassium voltage-gated channel subfamily C member 3 (KSHIIID) (Voltage-gated potassium channel subunit Kv3.3)
[Kcnc4] Potassium voltage-gated channel subfamily C member 4 (Raw3) (Voltage-gated potassium channel subunit Kv3.4)
[Kcnc4] Potassium voltage-gated channel subfamily C member 4 (Voltage-gated potassium channel subunit Kv3.4)
[KCND2 KIAA1044] Potassium voltage-gated channel subfamily D member 2 (Voltage-gated potassium channel subunit Kv4.2)
[KCND1] Potassium voltage-gated channel subfamily D member 1 (Voltage-gated potassium channel subunit Kv4.1)
[Kcnc2] Potassium voltage-gated channel subfamily C member 2 (Shaw-like potassium channel) (Voltage-gated potassium channel Kv3.2)
[KCND3] Potassium voltage-gated channel subfamily D member 3 (Voltage-gated potassium channel subunit Kv4.3)
[KCNC2] Potassium voltage-gated channel subfamily C member 2 (Shaw-like potassium channel) (Voltage-gated potassium channel Kv3.2)
[Kcnd3] Potassium voltage-gated channel subfamily D member 3 (Voltage-gated potassium channel subunit Kv4.3)
[Kcna3] Potassium voltage-gated channel subfamily A member 3 (RCK3) (RGK5) (Voltage-gated potassium channel subunit Kv1.3) (Voltage-gated potassium channel subunit Kv3)
[Kcnb1] Potassium voltage-gated channel subfamily B member 1 (Delayed rectifier potassium channel 1) (DRK1) (Voltage-gated potassium channel subunit Kv2.1)
[KCND2] Potassium voltage-gated channel subfamily D member 2 (Voltage-gated potassium channel subunit Kv4.2)
[Kcna5] Potassium voltage-gated channel subfamily A member 5 (Voltage-gated potassium channel subunit Kv1.5) (KV1-5)
[Kcne1] Potassium voltage-gated channel subfamily E member 1 (Delayed rectifier potassium channel subunit IsK) (IKs producing slow voltage-gated potassium channel subunit beta Mink) (Minimal potassium channel)
[KCND2] Potassium voltage-gated channel subfamily D member 2 (Voltage-gated potassium channel subunit Kv4.2)
[Kcna4] Potassium voltage-gated channel subfamily A member 4 (Voltage-gated potassium channel subunit Kv1.4)
[KCNA4 KCNA4L] Potassium voltage-gated channel subfamily A member 4 (HPCN2) (Voltage-gated K(+) channel HuKII) (Voltage-gated potassium channel HBK4) (Voltage-gated potassium channel HK1) (Voltage-gated potassium channel subunit Kv1.4)
[KCNA1] Potassium voltage-gated channel subfamily A member 1 (Voltage-gated K(+) channel HuKI) (Voltage-gated potassium channel HBK1) (Voltage-gated potassium channel subunit Kv1.1)
[KCNA2] Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)
[KCNQ1 KCNA8 KCNA9 KVLQT1] Potassium voltage-gated channel subfamily KQT member 1 (IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1) (KQT-like 1) (Voltage-gated potassium channel subunit Kv7.1)
[Kcnh1 Eag] Potassium voltage-gated channel subfamily H member 1 (Ether-a-go-go potassium channel 1) (EAG channel 1) (EAG1) (m-eag) (Voltage-gated potassium channel subunit Kv10.1)

Bibliography :