GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Potassium voltage-gated channel subfamily KQT member 2 (KQT-like 2) (Potassium channel subunit alpha KvLQT2) (Voltage-gated potassium channel subunit Kv7.2)

 KCNQ2_RAT               Reviewed;         852 AA.
O88943;
01-JUN-2001, integrated into UniProtKB/Swiss-Prot.
01-NOV-1998, sequence version 1.
13-FEB-2019, entry version 149.
RecName: Full=Potassium voltage-gated channel subfamily KQT member 2 {ECO:0000305};
AltName: Full=KQT-like 2;
AltName: Full=Potassium channel subunit alpha KvLQT2;
AltName: Full=Voltage-gated potassium channel subunit Kv7.2;
Name=Kcnq2 {ECO:0000312|RGD:621504};
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
TISSUE=Brain;
Derst C., Preisig-Mueller R., Hennighausen A., Daut J.;
Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, AND SUBCELLULAR
LOCATION.
TISSUE=Brain;
PubMed=11038262; DOI=10.1016/S0169-328X(00)00146-7;
Jow F., Wang K.-W.;
"Cloning and functional expression of rKCNQ2 K(+) channel from rat
brain.";
Brain Res. Mol. Brain Res. 80:269-278(2000).
[3]
NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, FUNCTION,
SUBCELLULAR LOCATION, AND SUBUNIT.
TISSUE=Brain, and Sympathetic ganglion;
PubMed=11230508; DOI=10.1111/j.1469-7793.2001.0347i.x;
Pan Z., Selyanko A.A., Hadley J.K., Brown D.A., Dixon J.E.,
McKinnon D.;
"Alternative splicing of KCNQ2 potassium channel transcripts
contributes to the functional diversity of M-currents.";
J. Physiol. (Lond.) 531:347-358(2001).
[4]
TISSUE SPECIFICITY.
PubMed=9836639; DOI=10.1126/science.282.5395.1890;
Wang H.-S., Pan Z., Shi W., Brown B.S., Wymore R.S., Cohen I.S.,
Dixon J.E., McKinnon D.;
"KCNQ2 and KCNQ3 potassium channel subunits: molecular correlates of
the M-channel.";
Science 282:1890-1893(1998).
[5]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-489; SER-655; SER-781
AND SER-783, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
PubMed=22673903; DOI=10.1038/ncomms1871;
Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A.,
Lundby C., Olsen J.V.;
"Quantitative maps of protein phosphorylation sites across 14
different rat organs and tissues.";
Nat. Commun. 3:876-876(2012).
-!- FUNCTION: Associates with KCNQ3 to form a potassium channel with
essentially identical properties to the channel underlying the
native M-current, a slowly activating and deactivating potassium
conductance which plays a critical role in determining the
subthreshold electrical excitability of neurons as well as the
responsiveness to synaptic inputs. Therefore, it is important in
the regulation of neuronal excitability. KCNQ2 current is blocked
by barium and tetraethylammonium whereas 4-aminopyridine and
charybdotoxin have no effect on KCNQ2 current. Tyrosine kinase
inhibitors genistein or herbimycin a markedly down-regulate KCNQ2
current. As the native M-channel, the potassium channel composed
of KCNQ2 and KCNQ3 is also suppressed by activation of the
muscarinic acetylcholine receptor CHRM1.
{ECO:0000269|PubMed:11038262, ECO:0000269|PubMed:11230508}.
-!- SUBUNIT: Heterotetramer with KCNQ3; form the heterotetrameric M
potassium channel (PubMed:11230508). Interacts with calmodulin;
the interaction is calcium-independent, constitutive and
participates to the proper assembly of a functional
heterotetrameric M channel. May associate with KCNE2 (By
similarity). Interacts with IQCJ-SCHIP1 (By similarity).
{ECO:0000250|UniProtKB:O43526, ECO:0000250|UniProtKB:Q9Z351,
ECO:0000269|PubMed:11230508}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:11038262,
ECO:0000269|PubMed:11230508}; Multi-pass membrane protein
{ECO:0000255}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=9;
Comment=Splice isoforms fell into three classes, those that
contain an in frame exon 16 (Isoforms A-I) those that contain an
out-of-frame exon 16 due to an alternative splice junction in
exon 14 and those that terminate prematurely to exon 16. Only
the forms containing an in frame exon 16 are able to form
functional channels. A similar splice pattern is also produced
for splice variants that contain an out-of-frame exon 16. A wide
variety of different truncated isoforms were isolated for splice
variants that terminate prematurely to exon 16.;
Name=A;
IsoId=O88943-1; Sequence=Displayed;
Name=B;
IsoId=O88943-2; Sequence=VSP_001009, VSP_001011;
Name=C;
IsoId=O88943-3; Sequence=VSP_001007;
Name=D;
IsoId=O88943-4; Sequence=VSP_001008, VSP_001010;
Name=E;
IsoId=O88943-5; Sequence=VSP_001008;
Name=F;
IsoId=O88943-6; Sequence=VSP_001007, VSP_001008, VSP_001010;
Name=G;
IsoId=O88943-7; Sequence=VSP_001011;
Name=H;
IsoId=O88943-8; Sequence=VSP_001007, VSP_001008;
Name=I;
IsoId=O88943-9; Sequence=VSP_001010;
-!- TISSUE SPECIFICITY: Expressed in brain and sympathetic ganglia. In
brain, expressed in cortex, hippocampus, and cerebellum. In
sympathetic ganglia, expressed at lower levels in celiac ganglia
and superior mesenteric ganglia than in superior cervical ganglia.
{ECO:0000269|PubMed:9836639}.
-!- DOMAIN: The segment S4 is probably the voltage-sensor and is
characterized by a series of positively charged amino acids at
every third position. {ECO:0000250}.
-!- PTM: KCNQ2/KCNQ3 heteromeric current can be increased by
intracellular cyclic AMP, an effect that depends on
phosphorylation of Ser-52 in the N-terminal region.
{ECO:0000250|UniProtKB:O43526}.
-!- PTM: KCNQ2/KCNQ3 are ubiquitinated by NEDD4L. Ubiquitination leads
to protein degradation. Degradation induced by NEDD4L is inhibited
by USP36. {ECO:0000250|UniProtKB:O43526}.
-!- MISCELLANEOUS: When coexpressed with KCNQ3 subunit in CHO cells or
Xenopus oocytes, isoform B was found to have significantly
different deactivation-activation kinetics. The kinetics was 2.5
times more slowly than the kinetics of other isoforms. The
presence of exon 15a in isoform B accounts for the slow
deactivation-activation kinetics. Alternative splicing of the
KCNQ2 gene may contribute to the variation in M-current kinetics
seen in vivo.
-!- SIMILARITY: Belongs to the potassium channel family. KQT (TC
1.A.1.15) subfamily. Kv7.2/KCNQ2 sub-subfamily. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF087453; AAC36722.1; -; mRNA.
RefSeq; NP_579856.1; NM_133322.1. [O88943-1]
UniGene; Rn.33317; -.
ProteinModelPortal; O88943; -.
BioGrid; 251003; 2.
MINT; O88943; -.
STRING; 10116.ENSRNOP00000043732; -.
BindingDB; O88943; -.
ChEMBL; CHEMBL5530; -.
iPTMnet; O88943; -.
PhosphoSitePlus; O88943; -.
SwissPalm; O88943; -.
PaxDb; O88943; -.
PRIDE; O88943; -.
GeneID; 170848; -.
KEGG; rno:170848; -.
UCSC; RGD:621504; rat. [O88943-1]
CTD; 3785; -.
RGD; 621504; Kcnq2.
eggNOG; KOG1419; Eukaryota.
eggNOG; COG1226; LUCA.
HOGENOM; HOG000220839; -.
HOVERGEN; HBG059014; -.
InParanoid; O88943; -.
KO; K04927; -.
OrthoDB; 1168835at2759; -.
PRO; PR:O88943; -.
Proteomes; UP000002494; Unplaced.
GO; GO:0043194; C:axon initial segment; IBA:GO_Central.
GO; GO:0016021; C:integral component of membrane; IBA:GO_Central.
GO; GO:0005887; C:integral component of plasma membrane; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; IDA:UniProtKB.
GO; GO:0032991; C:protein-containing complex; IDA:RGD.
GO; GO:0008076; C:voltage-gated potassium channel complex; IDA:UniProtKB.
GO; GO:0005516; F:calmodulin binding; ISS:UniProtKB.
GO; GO:0005251; F:delayed rectifier potassium channel activity; IBA:GO_Central.
GO; GO:0047485; F:protein N-terminus binding; IPI:RGD.
GO; GO:0005249; F:voltage-gated potassium channel activity; IDA:UniProtKB.
GO; GO:0071805; P:potassium ion transmembrane transport; IDA:UniProtKB.
GO; GO:0034765; P:regulation of ion transmembrane transport; IEA:UniProtKB-KW.
InterPro; IPR020969; Ankyrin-G_BS.
InterPro; IPR005821; Ion_trans_dom.
InterPro; IPR003937; K_chnl_volt-dep_KCNQ.
InterPro; IPR003947; K_chnl_volt-dep_KCNQ2.
InterPro; IPR013821; K_chnl_volt-dep_KCNQ_C.
InterPro; IPR028325; VG_K_chnl.
PANTHER; PTHR11537; PTHR11537; 1.
PANTHER; PTHR11537:SF6; PTHR11537:SF6; 1.
Pfam; PF00520; Ion_trans; 1.
Pfam; PF03520; KCNQ_channel; 1.
Pfam; PF11956; KCNQC3-Ank-G_bd; 1.
PRINTS; PR00169; KCHANNEL.
PRINTS; PR01461; KCNQ2CHANNEL.
PRINTS; PR01459; KCNQCHANNEL.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome; Ion channel;
Ion transport; Membrane; Phosphoprotein; Potassium; Potassium channel;
Potassium transport; Reference proteome; Transmembrane;
Transmembrane helix; Transport; Ubl conjugation;
Voltage-gated channel.
CHAIN 1 852 Potassium voltage-gated channel subfamily
KQT member 2.
/FTId=PRO_0000054032.
TOPO_DOM 1 91 Cytoplasmic. {ECO:0000255}.
TRANSMEM 92 112 Helical; Name=Segment S1. {ECO:0000255}.
TOPO_DOM 113 122 Extracellular. {ECO:0000255}.
TRANSMEM 123 143 Helical; Name=Segment S2. {ECO:0000255}.
TOPO_DOM 144 166 Cytoplasmic. {ECO:0000255}.
TRANSMEM 167 187 Helical; Name=Segment S3. {ECO:0000255}.
TOPO_DOM 188 197 Extracellular. {ECO:0000255}.
TRANSMEM 198 221 Helical; Voltage-sensor; Name=Segment S4.
{ECO:0000255}.
TOPO_DOM 222 231 Cytoplasmic. {ECO:0000255}.
TRANSMEM 232 252 Helical; Name=Segment S5. {ECO:0000255}.
TOPO_DOM 253 264 Extracellular. {ECO:0000255}.
INTRAMEM 265 285 Pore-forming; Name=Segment H5.
{ECO:0000255}.
TOPO_DOM 286 291 Extracellular. {ECO:0000255}.
TRANSMEM 292 312 Helical; Name=Segment S6. {ECO:0000255}.
TOPO_DOM 313 852 Cytoplasmic. {ECO:0000255}.
REGION 317 522 Mediates interaction with calmodulin.
{ECO:0000250|UniProtKB:O43526}.
MOTIF 277 282 Selectivity filter. {ECO:0000250}.
MOD_RES 52 52 Phosphoserine; by PKA.
{ECO:0000250|UniProtKB:O43526}.
MOD_RES 448 448 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Z351}.
MOD_RES 450 450 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Z351}.
MOD_RES 454 454 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Z351}.
MOD_RES 458 458 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Z351}.
MOD_RES 460 460 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Z351}.
MOD_RES 489 489 Phosphoserine.
{ECO:0000244|PubMed:22673903}.
MOD_RES 655 655 Phosphoserine.
{ECO:0000244|PubMed:22673903}.
MOD_RES 781 781 Phosphoserine.
{ECO:0000244|PubMed:22673903}.
MOD_RES 783 783 Phosphoserine.
{ECO:0000244|PubMed:22673903}.
VAR_SEQ 373 382 Missing (in isoform C, isoform F and
isoform H). {ECO:0000305}.
/FTId=VSP_001007.
VAR_SEQ 416 416 S -> SKGRPCRGCLCGCRPGHSS (in isoform D,
isoform E, isoform F and isoform H).
{ECO:0000305}.
/FTId=VSP_001008.
VAR_SEQ 417 428 Missing (in isoform B). {ECO:0000305}.
/FTId=VSP_001009.
VAR_SEQ 491 491 Missing (in isoform D, isoform F and
isoform I). {ECO:0000305}.
/FTId=VSP_001010.
VAR_SEQ 571 571 R -> RIDMIVGPPPPSTPRHKKYPTKGPTAPSRESPQYSP
R (in isoform B and isoform G).
{ECO:0000305}.
/FTId=VSP_001011.
SEQUENCE 852 AA; 93949 MW; 82A5FE462A5F259A CRC64;
MVQKSRNGGV YPGTSGEKKL KVGFVGLDPG APDSTRDGAL LIAGSEAPKR GSVLSKPRTG
GAGAGKPPKR NAFYRKLQNF LYNVLERPRG WAFIYHAYVF LLVFSCLVLS VFSTIKEYEK
SSEGALYILE IVTIVVFGVE YFVRIWAAGC CCRYRGWRGR LKFARKPFCV IDIMVLIASI
AVLAAGSQGN VFATSALRSL RFLQILRMIR MDRRGGTWKL LGSVVYAHSK ELVTAWYIGF
LCLILASFLV YLAEKGENDH FDTYADALWW GLITLTTIGY GDKYPQTWNG RLLAATFTLI
GVSFFALPAG ILGSGFALKV QEQHRQKHFE KRRNPAAGLI QSAWRFYATN LSRTDLHSTW
QYYERTVTVP MISSQTQTYG ASRLIPPLNQ LEMLRNLKSK SGLTFRKEPQ PEPSPSQKVS
LKDRVFSSPR GVAAKGKGSP QAQTVRRSPS ADQSLDDSPS KVPKSWSFGD RSRARQAFRI
KGAASRQNSE EASLPGEDIV EDNKSCNCEF VTEDLTPGLK VSIRAVCVMR FLVSKRKFKE
SLRPYDVMDV IEQYSAGHLD MLSRIKSLQS RVDQIVGRGP TITDKDRTKG PAETELPEDP
SMMGRLGKVE KQVLSMEKKL DFLVSIYTQR MGIPPAETEA YFGAKEPEPA PPYHSPEDSR
DHADKHGCII KIVRSTSSTG QRKYAAPPVM PPAECPPSTS WQQSHQRHGT SPVGDHGSLV
RIPPPPAHER SLSAYSGGNR ASTEFLRLEG TPACRPSEAA LRDSDTSISI PSVDHEELER
SFSGFSISQS KENLNALASC YAAVAPCAKV RPYIAEGESD TDSDLCTPCG PPPRSATGEG
PFGDVAWAGP RK


Related products :

Catalog number Product name Quantity
18-003-42664 Potassium voltage-gated channel subfamily KQT member 2 - Voltage-gated potassium channel subunit Kv7.2; Neuroblastoma-specific potassium channel subunit alpha KvLQT2; KQT-like 2 Polyclonal 0.1 mg Protein A
18-003-42663 Potassium voltage-gated channel subfamily KQT member 2 - Voltage-gated potassium channel subunit Kv7.2; Neuroblastoma-specific potassium channel subunit alpha KvLQT2; KQT-like 2 Polyclonal 0.05 mg Aff Pur
28-297 This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. 0.1 mg
18-662-20074 Potassium voltage-gated channel subfamily C member 1 - Voltage-gated potassium channel subunit Kv3.1; Kv4; NGK2; RAW2 Polyclonal 0.1 ml
18-662-20009 Potassium voltage-gated channel subfamily B member 2 - Voltage-gated potassium channel subunit Kv2.2; CDRK Polyclonal 0.1 ml
18-003-42629 Potassium voltage-gated channel subfamily D member 3 - Voltage-gated potassium channel subunit Kv4.3 Polyclonal 0.1 mg Protein A
18-003-43133 Potassium voltage-gated channel subfamily G member 1 - Voltage-gated potassium channel subunit Kv6.1; kH2 Polyclonal 0.05 mg Aff Pur
18-003-42631 Cyclic GMP gated potassium channel - Potassium voltage-gated channel. shaker-related subfamily. member 10 Polyclonal 0.1 mg Protein A
18-003-42669 Kv channel-interacting protein 2 - KChIP2; A-type potassium channel modulatory protein 2; Potassium channel-interacting protein 2; Cardiac voltage-gated potassium channel modulatory subunit Polyclonal 0.05 mg Aff Pur
18-003-42670 Kv channel-interacting protein 2 - KChIP2; A-type potassium channel modulatory protein 2; Potassium channel-interacting protein 2; Cardiac voltage-gated potassium channel modulatory subunit Polyclonal 0.05 mg Aff Pur
Y062354 Anti-Potassium Channel Kv<_SUB>1.6 (Voltage-gated, Delayed-Rectifier Potassium Channel; RCK2; KV2) produced in rabbit Antibody 100ul
EIAAB26323 Four domain-type voltage-gated ion channel alpha-1 subunit,Nalcn,Nca,Rat,Rattus norvegicus,Sodium leak channel non-selective protein,Vgcnl1,Voltage gated channel-like protein 1
EIAAB05033 CACNA1H,Homo sapiens,Human,Low-voltage-activated calcium channel alpha1 3.2 subunit,Voltage-dependent T-type calcium channel subunit alpha-1H,Voltage-gated calcium channel subunit alpha Cav3.2
E1366h Rat ELISA Kit FOR Potassium voltage-gated channel subfamily H member 1 96T
KCNA5_RAT Rat ELISA Kit FOR Potassium voltage-gated channel subfamily A member 5 96T
KCNQ1_PIG Pig ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 1 96T
E15045p Pig ELISA Kit FOR Potassium voltage-gated channel subfamily H member 2 96T
E0614m Rat ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 2 96T
KCNH4_RAT Rat ELISA Kit FOR Potassium voltage-gated channel subfamily H member 4 96T
PPAC_MOUSE Rat ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 1 96T
E0522m Rat ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 1 96T
E13768r Rat ELISA Kit FOR Potassium voltage-gated channel subfamily KQT member 4 96T
KCNH2_RAT Rat ELISA Kit FOR Potassium voltage-gated channel subfamily H member 2 96T
KCNG3_RAT Rat ELISA Kit FOR Potassium voltage-gated channel subfamily G member 3 96T
EH2214 Potassium voltage-gated channel subfamily B member 2 Elisa Kit 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1566: Citrate cycle (TCA cycle)
WP1614: 1- and 2-Methylnaphthalene degradation
WP1655: Geraniol degradation
WP2197: Endothelin
WP1626: Benzoate degradation via CoA ligation
WP1634: Butanoate metabolism
WP1644: DNA replication
WP1663: Homologous recombination
WP1671: Methane metabolism
WP1672: Mismatch repair
WP1680: Oxidative phosphorylation
WP1693: Purine metabolism
WP1694: Pyrimidine metabolism
WP1711: Trinitrotoluene degradation
WP1718: Vitamin B6 metabolism
WP2272: Pathogenic Escherichia coli infection
WP2292: Chemokine signaling pathway
WP1003: Ovarian Infertility Genes
WP1047: TNF-alpha NF-kB Signaling Pathway
WP1120: Ovarian Infertility Genes
WP1163: TNF-alpha NF-kB Signaling Pathway
WP1209: EBV LMP1 signaling
WP1224: EBV LMP1 signaling
WP1225: estrogen signalling
WP1340: Ovarian Infertility Genes

Related Genes :
[KCNQ2] Potassium voltage-gated channel subfamily KQT member 2 (KQT-like 2) (Neuroblastoma-specific potassium channel subunit alpha KvLQT2) (Voltage-gated potassium channel subunit Kv7.2)
[Kcnq2] Potassium voltage-gated channel subfamily KQT member 2 (KQT-like 2) (Potassium channel subunit alpha KvLQT2) (Voltage-gated potassium channel subunit Kv7.2)
[KCNQ1 KCNA8 KCNA9 KVLQT1] Potassium voltage-gated channel subfamily KQT member 1 (IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1) (KQT-like 1) (Voltage-gated potassium channel subunit Kv7.1)
[KCNQ5] Potassium voltage-gated channel subfamily KQT member 5 (KQT-like 5) (Potassium channel subunit alpha KvLQT5) (Voltage-gated potassium channel subunit Kv7.5)
[KCNQ3] Potassium voltage-gated channel subfamily KQT member 3 (KQT-like 3) (Potassium channel subunit alpha KvLQT3) (Voltage-gated potassium channel subunit Kv7.3)
[KCNQ4] Potassium voltage-gated channel subfamily KQT member 4 (KQT-like 4) (Potassium channel subunit alpha KvLQT4) (Voltage-gated potassium channel subunit Kv7.4)
[Kcnq3] Potassium voltage-gated channel subfamily KQT member 3 (KQT-like 3) (Potassium channel subunit alpha KvLQT3) (Voltage-gated potassium channel subunit Kv7.3)
[Kcnq3] Potassium voltage-gated channel subfamily KQT member 3 (KQT-like 3) (Potassium channel subunit alpha KvLQT3) (Voltage-gated potassium channel subunit Kv7.3)
[KCNQ3] Potassium voltage-gated channel subfamily KQT member 3 (KQT-like 3) (Potassium channel subunit alpha KvLQT3) (Voltage-gated potassium channel subunit Kv7.3)
[KCNE1] Potassium voltage-gated channel subfamily E member 1 (Delayed rectifier potassium channel subunit IsK) (IKs producing slow voltage-gated potassium channel subunit beta Mink) (Minimal potassium channel)
[Kcnc2] Potassium voltage-gated channel subfamily C member 2 (Potassium channel voltage-gated Shaw-related subfamily C member 2) (Shaw-like potassium channel) (Voltage-gated potassium channel subunit Kv3.2)
[KCNE2] Potassium voltage-gated channel subfamily E member 2 (MinK-related peptide 1) (Minimum potassium ion channel-related peptide 1) (Potassium channel subunit beta MiRP1)
[KCNA2] Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)
[KCNA4 KCNA4L] Potassium voltage-gated channel subfamily A member 4 (HPCN2) (Voltage-gated K(+) channel HuKII) (Voltage-gated potassium channel HBK4) (Voltage-gated potassium channel HK1) (Voltage-gated potassium channel subunit Kv1.4)
[Kcnc1] Potassium voltage-gated channel subfamily C member 1 (NGK2) (RAW2) (Voltage-gated potassium channel subunit Kv3.1) (Voltage-gated potassium channel subunit Kv4)
[KCNA1] Potassium voltage-gated channel subfamily A member 1 (Voltage-gated K(+) channel HuKI) (Voltage-gated potassium channel HBK1) (Voltage-gated potassium channel subunit Kv1.1)
[KCNC1] Potassium voltage-gated channel subfamily C member 1 (NGK2) (Voltage-gated potassium channel subunit Kv3.1) (Voltage-gated potassium channel subunit Kv4)
[Kcnc1] Potassium voltage-gated channel subfamily C member 1 (NGK2) (Voltage-gated potassium channel subunit Kv3.1) (Voltage-gated potassium channel subunit Kv4)
[KCNA5] Potassium voltage-gated channel subfamily A member 5 (HPCN1) (Voltage-gated potassium channel HK2) (Voltage-gated potassium channel subunit Kv1.5)
[Kcnb1] Potassium voltage-gated channel subfamily B member 1 (Delayed rectifier potassium channel 1) (DRK1) (Voltage-gated potassium channel subunit Kv2.1)
[KCNB1] Potassium voltage-gated channel subfamily B member 1 (Delayed rectifier potassium channel 1) (DRK1) (h-DRK1) (Voltage-gated potassium channel subunit Kv2.1)
[KCNH2 ERG ERG1 HERG] Potassium voltage-gated channel subfamily H member 2 (Eag homolog) (Ether-a-go-go-related gene potassium channel 1) (ERG-1) (Eag-related protein 1) (Ether-a-go-go-related protein 1) (H-ERG) (hERG-1) (hERG1) (Voltage-gated potassium channel subunit Kv11.1)
[Kcnh6 Erg2] Potassium voltage-gated channel subfamily H member 6 (Ether-a-go-go-related gene potassium channel 2) (ERG-2) (Eag-related protein 2) (Ether-a-go-go-related protein 2) (Voltage-gated potassium channel subunit Kv11.2)
[Kcna2] Potassium voltage-gated channel subfamily A member 2 (RAK) (RBK2) (RCK5) (Voltage-gated potassium channel subunit Kv1.2)
[KCNB1] Potassium voltage-gated channel subfamily B member 1 (Delayed rectifier potassium channel 1) (DRK1) (Voltage-gated potassium channel subunit Kv2.1)
[KCNH5 EAG2] Potassium voltage-gated channel subfamily H member 5 (Ether-a-go-go potassium channel 2) (hEAG2) (Voltage-gated potassium channel subunit Kv10.2)
[Kcnh2 Erg Merg1] Potassium voltage-gated channel subfamily H member 2 (Ether-a-go-go-related gene potassium channel 1) (ERG-1) (Eag-related protein 1) (Ether-a-go-go-related protein 1) (MERG) (Voltage-gated potassium channel subunit Kv11.1)
[KCNH3 KIAA1282] Potassium voltage-gated channel subfamily H member 3 (Brain-specific eag-like channel 1) (BEC1) (Ether-a-go-go-like potassium channel 2) (ELK channel 2) (ELK2) (Voltage-gated potassium channel subunit Kv12.2)
[Kcnd2] Potassium voltage-gated channel subfamily D member 2 (RK5) (Shal1) (Voltage-gated potassium channel subunit Kv4.2)
[KCND2 KIAA1044] Potassium voltage-gated channel subfamily D member 2 (Voltage-gated potassium channel subunit Kv4.2)

Bibliography :