GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Protein FAM168A (Tongue cancer chemotherapy resistance-associated protein 1)

 F168A_HUMAN             Reviewed;         244 AA.
Q92567; A2ICY2; A2ID81; Q86UG2;
26-APR-2004, integrated into UniProtKB/Swiss-Prot.
26-APR-2004, sequence version 2.
13-FEB-2019, entry version 137.
RecName: Full=Protein FAM168A;
AltName: Full=Tongue cancer chemotherapy resistance-associated protein 1;
Name=FAM168A; Synonyms=KIAA0280, TCRP1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
He Z., Zhou M., Liu X.;
"Cloning and characterization of a novel gene TCRP1 associated with
tongue cancer chemotherapy resistance.";
Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=9039502; DOI=10.1093/dnares/3.5.321;
Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O.,
Tanaka A., Kotani H., Miyajima N., Nomura N.;
"Prediction of the coding sequences of unidentified human genes. VI.
The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by
analysis of cDNA clones from cell line KG-1 and brain.";
DNA Res. 3:321-329(1996).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Spleen;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Blood;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19413330; DOI=10.1021/ac9004309;
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,
Mohammed S.;
"Lys-N and trypsin cover complementary parts of the phosphoproteome in
a refined SCX-based approach.";
Anal. Chem. 81:4493-4501(2009).
[6]
FUNCTION, AND INVOLVEMENT IN DISEASE.
PubMed=21334329; DOI=10.1016/j.febslet.2010.12.045;
Gu Y., Fan S., Xiong Y., Peng B., Zheng G., Yu Y., Ouyang Y., He Z.;
"Cloning and functional characterization of TCRP1, a novel gene
mediating resistance to cisplatin in an oral squamous cell carcinoma
cell line.";
FEBS Lett. 585:881-887(2011).
[7]
FUNCTION, AND INVOLVEMENT IN DISEASE.
PubMed=21603883; DOI=10.1007/s11010-011-0880-8;
Gu Y., Fan S., Liu B., Zheng G., Yu Y., Ouyang Y., He Z.;
"TCRP1 promotes radioresistance of oral squamous cell carcinoma cells
via Akt signal pathway.";
Mol. Cell. Biochem. 357:107-113(2011).
[8]
INTERACTION WITH FAM168B.
PubMed=22771904; DOI=10.1016/j.febslet.2012.06.043;
Mishra M., Lee S., Lin M.K., Yamashita T., Heese K.;
"Characterizing the neurite outgrowth inhibitory effect of Mani.";
FEBS Lett. 586:3018-3023(2012).
[9]
FUNCTION, AND INTERACTION WITH AKT1 AND MT1X.
PubMed=23251525; DOI=10.1371/journal.pone.0051413;
Peng B., Gu Y., Xiong Y., Zheng G., He Z.;
"Microarray-assisted pathway analysis identifies MT1X & NFkappaB as
mediators of TCRP1-associated resistance to cisplatin in oral squamous
cell carcinoma.";
PLoS ONE 7:E51413-E51413(2012).
[10]
FUNCTION, INVOLVEMENT IN DISEASE, AND INTERACTION WITH POLB.
PubMed=25260657; DOI=10.1007/s11010-014-2217-x;
Liu X., Wang C., Gu Y., Zhang Z., Zheng G., He Z.;
"TCRP1 contributes to cisplatin resistance by preventing Pol beta
degradation in lung cancer cells.";
Mol. Cell. Biochem. 398:175-183(2015).
-!- FUNCTION: In cancer context, protects cells from induced-DNA
damage and apoptosis. Acts, at least in part, through
PI3K/AKT/NFKB signaling pathway and by preventing POLB
degradation. Decreases POLB ubiquitation and stabilizes its
protein levels. {ECO:0000269|PubMed:21334329,
ECO:0000269|PubMed:21603883, ECO:0000269|PubMed:23251525,
ECO:0000269|PubMed:25260657}.
-!- SUBUNIT: Interacts with POLB (PubMed:25260657). Interacts with
AKT1 and MT1X (PubMed:23251525). May interact with FAM168B
(PubMed:22771904). {ECO:0000269|PubMed:22771904,
ECO:0000269|PubMed:23251525, ECO:0000269|PubMed:25260657}.
-!- INTERACTION:
Q6P1W5:C1orf94; NbExp=3; IntAct=EBI-7957930, EBI-946029;
Q13137:CALCOCO2; NbExp=3; IntAct=EBI-7957930, EBI-739580;
O75553:DAB1; NbExp=3; IntAct=EBI-7957930, EBI-7875264;
Q15038:DAZAP2; NbExp=3; IntAct=EBI-7957930, EBI-724310;
Q86UW9:DTX2; NbExp=6; IntAct=EBI-7957930, EBI-740376;
A0A0S2Z4Q4:HGS; NbExp=3; IntAct=EBI-11978259, EBI-16429135;
O14964:HGS; NbExp=5; IntAct=EBI-11978259, EBI-740220;
Q9P2K6:KLHL42; NbExp=3; IntAct=EBI-7957930, EBI-739890;
Q96HR8:NAF1; NbExp=3; IntAct=EBI-7957930, EBI-2515597;
Q96DC9:OTUB2; NbExp=3; IntAct=EBI-7957930, EBI-746259;
Q96BN8:OTULIN; NbExp=3; IntAct=EBI-7957930, EBI-750730;
P86479:PRR20C; NbExp=3; IntAct=EBI-7957930, EBI-10172814;
Q9Y2K5-2:R3HDM2; NbExp=3; IntAct=EBI-7957930, EBI-10326419;
Q93062:RBPMS; NbExp=5; IntAct=EBI-7957930, EBI-740322;
Q93062-3:RBPMS; NbExp=4; IntAct=EBI-11978259, EBI-740343;
Q9BQY4:RHOXF2; NbExp=8; IntAct=EBI-11978259, EBI-372094;
Q15637:SF1; NbExp=3; IntAct=EBI-7957930, EBI-744603;
Q8WU79:SMAP2; NbExp=3; IntAct=EBI-7957930, EBI-2822515;
Q5TAL4:SNRPC; NbExp=3; IntAct=EBI-7957930, EBI-10246938;
O75177:SS18L1; NbExp=4; IntAct=EBI-7957930, EBI-744674;
Q86VP1:TAX1BP1; NbExp=3; IntAct=EBI-7957930, EBI-529518;
Q15025:TNIP1; NbExp=3; IntAct=EBI-7957930, EBI-357849;
Q9BSL1:UBAC1; NbExp=4; IntAct=EBI-11978259, EBI-749370;
Q8TF42:UBASH3B; NbExp=3; IntAct=EBI-7957930, EBI-1380492;
Q13404:UBE2V1; NbExp=3; IntAct=EBI-7957930, EBI-1050671;
A5D8V6:VPS37C; NbExp=3; IntAct=EBI-7957930, EBI-2559305;
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q92567-1; Sequence=Displayed;
Name=2;
IsoId=Q92567-2; Sequence=VSP_010095;
Name=3;
IsoId=Q92567-3; Sequence=VSP_010095, VSP_034630;
-!- DISEASE: Note=Associated with cisplatin (DDP)-resistance and
radioresistance in the treatment of lung cancer as well as oral
squamous cell carcinoma and poor clinical outcome in patients.
{ECO:0000269|PubMed:21334329, ECO:0000269|PubMed:21603883,
ECO:0000269|PubMed:23251525, ECO:0000269|PubMed:25260657}.
-!- SIMILARITY: Belongs to the FAM168 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAA13408.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; EF363480; ABM69287.1; -; mRNA.
EMBL; EF197985; ABM69272.1; -; mRNA.
EMBL; D87470; BAA13408.1; ALT_INIT; mRNA.
EMBL; AK292054; BAF84743.1; -; mRNA.
EMBL; BC052341; AAH52341.1; -; mRNA.
CCDS; CCDS41689.1; -. [Q92567-2]
CCDS; CCDS66165.1; -. [Q92567-3]
CCDS; CCDS73346.1; -. [Q92567-1]
RefSeq; NP_001272979.1; NM_001286050.1. [Q92567-1]
RefSeq; NP_001272980.1; NM_001286051.1. [Q92567-3]
RefSeq; NP_055974.1; NM_015159.2. [Q92567-2]
UniGene; Hs.475334; -.
ProteinModelPortal; Q92567; -.
SMR; Q92567; -.
BioGrid; 116810; 89.
IntAct; Q92567; 73.
MINT; Q92567; -.
STRING; 9606.ENSP00000348852; -.
iPTMnet; Q92567; -.
PhosphoSitePlus; Q92567; -.
BioMuta; FAM168A; -.
DMDM; 46576628; -.
EPD; Q92567; -.
jPOST; Q92567; -.
MaxQB; Q92567; -.
PaxDb; Q92567; -.
PeptideAtlas; Q92567; -.
PRIDE; Q92567; -.
ProteomicsDB; 75324; -.
ProteomicsDB; 75325; -. [Q92567-2]
ProteomicsDB; 75326; -. [Q92567-3]
DNASU; 23201; -.
Ensembl; ENST00000064778; ENSP00000064778; ENSG00000054965. [Q92567-1]
Ensembl; ENST00000356467; ENSP00000348852; ENSG00000054965. [Q92567-2]
Ensembl; ENST00000450446; ENSP00000390501; ENSG00000054965. [Q92567-3]
GeneID; 23201; -.
KEGG; hsa:23201; -.
UCSC; uc001oty.3; human. [Q92567-1]
CTD; 23201; -.
DisGeNET; 23201; -.
EuPathDB; HostDB:ENSG00000054965.10; -.
GeneCards; FAM168A; -.
H-InvDB; HIX0009919; -.
HGNC; HGNC:28999; FAM168A.
HPA; HPA037580; -.
MIM; 616316; gene.
neXtProt; NX_Q92567; -.
OpenTargets; ENSG00000054965; -.
PharmGKB; PA162387077; -.
eggNOG; ENOG410IHUV; Eukaryota.
eggNOG; ENOG410XR79; LUCA.
GeneTree; ENSGT00390000005140; -.
HOGENOM; HOG000073527; -.
HOVERGEN; HBG052179; -.
InParanoid; Q92567; -.
OMA; CATEGTF; -.
OrthoDB; 1348118at2759; -.
PhylomeDB; Q92567; -.
TreeFam; TF331128; -.
ChiTaRS; FAM168A; human.
GenomeRNAi; 23201; -.
PRO; PR:Q92567; -.
Proteomes; UP000005640; Chromosome 11.
Bgee; ENSG00000054965; Expressed in 220 organ(s), highest expression level in C1 segment of cervical spinal cord.
Genevisible; Q92567; HS.
GO; GO:1905053; P:positive regulation of base-excision repair; IDA:UniProtKB.
InterPro; IPR029247; FAM168A/MANI.
PANTHER; PTHR31844; PTHR31844; 1.
Pfam; PF14944; TCRP1; 1.
1: Evidence at protein level;
Acetylation; Alternative splicing; Complete proteome; Methylation;
Reference proteome.
CHAIN 1 244 Protein FAM168A.
/FTId=PRO_0000050742.
MOD_RES 1 1 N-acetylmethionine.
{ECO:0000244|PubMed:19413330}.
MOD_RES 102 102 Asymmetric dimethylarginine.
{ECO:0000250|UniProtKB:Q8BGZ2}.
VAR_SEQ 51 59 Missing (in isoform 2 and isoform 3).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334,
ECO:0000303|Ref.1}.
/FTId=VSP_010095.
VAR_SEQ 102 208 RYTAGTPYKVPPTQSNTAPPPYSPSPNPYQTAMYPIRSAYP
QQNLYAQGAYYTQPVYAAQPHVIHHTTVVQPNSIPSAIYPA
PVAAPRTNGVAMGMVAGTTMAMSAG -> S (in
isoform 3). {ECO:0000303|Ref.1}.
/FTId=VSP_034630.
SEQUENCE 244 AA; 26184 MW; 60E3E9621665D30C CRC64;
MNPVYSPVQP GAPYGNPKNM AYTGYPTAYP AAAPAYNPSL YPTNSPSYAP EFQFLHSAYA
TLLMKQAWPQ NSSSCGTEGT FHLPVDTGTE NRTYQASSAA FRYTAGTPYK VPPTQSNTAP
PPYSPSPNPY QTAMYPIRSA YPQQNLYAQG AYYTQPVYAA QPHVIHHTTV VQPNSIPSAI
YPAPVAAPRT NGVAMGMVAG TTMAMSAGTL LTTPQHTAIG AHPVSMPTYR AQGTPAYSYV
PPHW


Related products :

Catalog number Product name Quantity
EIAAB13788 FAM168A,Homo sapiens,Human,KIAA0280,Protein FAM168A,TCRP1,Tongue cancer chemotherapy resistance-associated protein 1
E7563h Human Tongue Cancer Chemotherapy Resistance Associ 96T
20-783-74648 MOUSE ANTI HUMAN BREAST CANCER RESISTANCE PROTEIN - Placenta-specific ATP-binding cassette transporter; Breast cancer resistance protein; Mitoxantrone resistance-associated protein; CD338 antigen; CDw 1 ml
E0960h ELISA ABCG2,ABCP,ATP-binding cassette sub-family G member 2,BCRP,BCRP1,Breast cancer resistance protein,CDw338,Homo sapiens,Human,Mitoxantrone resistance-associated protein,MXR,Placenta-specific ATP-b 96T
U0960h CLIA ABCG2,ABCP,ATP-binding cassette sub-family G member 2,BCRP,BCRP1,Breast cancer resistance protein,CDw338,Homo sapiens,Human,Mitoxantrone resistance-associated protein,MXR,Placenta-specific ATP-bi 96T
E0960h ELISA kit ABCG2,ABCP,ATP-binding cassette sub-family G member 2,BCRP,BCRP1,Breast cancer resistance protein,CDw338,Homo sapiens,Human,Mitoxantrone resistance-associated protein,MXR,Placenta-specific 96T
EIAAB25874 Influenza resistance protein,Interferon-induced GTP-binding protein Mx1,Mouse,Mus musculus,Mx1,Myxoma resistance protein 1,Myxovirus resistance protein 1
F168A_MOUSE ELISA Kit FOR Protein FAM168A; organism: Mouse; gene name: Fam168a 96T
F168A_HUMAN ELISA Kit FOR Protein FAM168A; organism: Human; gene name: FAM168A 96T
CSB-EL008124HU Human Protein FAM168A(FAM168A) ELISA kit SpeciesHuman 96T
CSB-EL008124MO Mouse Protein FAM168A(FAM168A) ELISA kit SpeciesMouse 96T
EIAAB13787 Fam168a,Kiaa0280,Mouse,Mus musculus,Protein FAM168A
G2971 Protein FAM168A (FAM168A), Human, ELISA Kit 96T
CSB-EL008124HU Human Protein FAM168A(FAM168A) ELISA kit 96T
CSB-EL008124MO Mouse Protein FAM168A(FAM168A) ELISA kit 96T
G2972 Protein FAM168A (FAM168A), Mouse, ELISA Kit 96T
orb60366 Isotretinoin It was developed to be used as a chemotherapy medication for the treatment of brain cancer, pancreatic cancer and more. For research use only. 1 g
EIAAB05298 C1q domain-containing protein 1,C1QDC1,CAPRIN2,Caprin-2,Cytoplasmic activation_proliferation-associated protein 2,EEG1,Gastric cancer multidrug resistance-associated protein,Homo sapiens,Human,KIAA187
bs-0662P Peptides: BCRP_ABCG2(breast cancer resistance protein) Protein Length:12-25 amino acids. 200ug lyophilized
MC-236 BCRP (Breast Cancer Resistance Protein) 1 mL
MC-236 BCRP (Breast Cancer Resistance Protein) 1 mL
EIAAB25876 Interferon-induced GTP-binding protein Mx1,Mx1,Myxoma resistance protein 1,Myxovirus resistance protein 1,Rat,Rattus norvegicus
EIAAB25877 Bos taurus,Bovine,Interferon-induced GTP-binding protein Mx1,MX1,Myxoma resistance protein 1,Myxovirus resistance protein 1
EIAAB25875 Interferon-induced GTP-binding protein Mx1,MX1,Myxoma resistance protein 1,Myxovirus resistance protein 1,Pig,Sus scrofa
MC-236 BCRP (Breast Cancer Resistance Protein) BXP_21 1 mL

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP2199: Seed Development
WP1049: G Protein Signaling Pathways
WP1165: G Protein Signaling Pathways
WP1371: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1493: Carbon assimilation C4 pathway
WP1502: Mitochondrial biogenesis
WP1531: Vitamin D synthesis
WP1566: Citrate cycle (TCA cycle)
WP1613: 1,4-Dichlorobenzene degradation
WP1616: ABC transporters
WP1624: Bacterial secretion system
WP1625: Base excision repair
WP1644: DNA replication
WP1650: Fluorobenzoate degradation
WP1654: gamma-Hexachlorocyclohexane degradation
WP1657: Glycerolipid metabolism
WP1659: Glycine, serine and threonine metabolism
WP1661: Glyoxylate and dicarboxylate metabolism
WP1663: Homologous recombination
WP1665: Limonene and pinene degradation
WP1672: Mismatch repair
WP1673: Naphthalene and anthracene degradation
WP1675: Nitrogen metabolism
WP1676: Non-homologous end-joining

Related Genes :
[AKT1 PKB RAC] RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha)
[POLB] DNA polymerase beta (EC 2.7.7.7) (EC 4.2.99.-)
[Akt1 Akt Rac] RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (AKT1 kinase) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha) (Thymoma viral proto-oncogene)
[UBE2V1 CROC1 UBE2V UEV1 P/OKcl.19] Ubiquitin-conjugating enzyme E2 variant 1 (UEV-1) (CROC-1) (TRAF6-regulated IKK activator 1 beta Uev1A)
[UBASH3B KIAA1959 STS1] Ubiquitin-associated and SH3 domain-containing protein B (EC 3.1.3.48) (Cbl-interacting protein p70) (Suppressor of T-cell receptor signaling 1) (STS-1) (T-cell ubiquitin ligand 2) (TULA-2) (Tyrosine-protein phosphatase STS1/TULA2)
[HGS HRS] Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110)
[CALCOCO2 NDP52] Calcium-binding and coiled-coil domain-containing protein 2 (Antigen nuclear dot 52 kDa protein) (Nuclear domain 10 protein NDP52) (Nuclear domain 10 protein 52) (Nuclear dot protein 52)
[Akt1] RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (RAC-PK-alpha)
[AKT1 PKB] RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (RAC-PK-alpha)
[VPS37C PML39] Vacuolar protein sorting-associated protein 37C (hVps37C) (ESCRT-I complex subunit VPS37C)
[OTULIN FAM105B] Ubiquitin thioesterase otulin (EC 3.4.19.12) (Deubiquitinating enzyme otulin) (OTU domain-containing deubiquitinase with linear linkage specificity) (Ubiquitin thioesterase Gumby)
[ABCG2 ABCP BCRP BCRP1 MXR] ATP-binding cassette sub-family G member 2 (Breast cancer resistance protein) (CDw338) (Mitoxantrone resistance-associated protein) (Placenta-specific ATP-binding cassette transporter) (Urate exporter) (CD antigen CD338)
[KMT2A ALL1 CXXC7 HRX HTRX MLL MLL1 TRX1] Histone-lysine N-methyltransferase 2A (Lysine N-methyltransferase 2A) (EC 2.1.1.43) (ALL-1) (CXXC-type zinc finger protein 7) (Myeloid/lymphoid or mixed-lineage leukemia) (Myeloid/lymphoid or mixed-lineage leukemia protein 1) (Trithorax-like protein) (Zinc finger protein HRX) [Cleaved into: MLL cleavage product N320 (N-terminal cleavage product of 320 kDa) (p320); MLL cleavage product C180 (C-terminal cleavage product of 180 kDa) (p180)]
[Abcg2 Abcp Bcrp1] ATP-binding cassette sub-family G member 2 (Breast cancer resistance protein 1 homolog) (Urate exporter) (CD antigen CD338)
[DPH1 DPH2L DPH2L1 OVCA1] 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 (EC 2.5.1.108) (Diphthamide biosynthesis protein 1) (Diphtheria toxin resistance protein 1) (Ovarian cancer-associated gene 1 protein) (S-adenosyl-L-methionine:L-histidine 3-amino-3-carboxypropyltransferase 1)
[BRCA1 RNF53] Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1)
[KNL1 CASC5 KIAA1570] Kinetochore scaffold 1 (ALL1-fused gene from chromosome 15q14 protein) (AF15q14) (Bub-linking kinetochore protein) (Blinkin) (Cancer susceptibility candidate gene 5 protein) (Cancer/testis antigen 29) (CT29) (Kinetochore-null protein 1) (Protein CASC5) (Protein D40/AF15q14)
[RRS1 RCH2 RRS1-S RSH4 SLH1 WRKY52 At5g45260/At5g45270 K9E15.2/K9E15.3] Disease resistance protein RRS1 (Disease resistance protein RCH2) (Disease resistance protein SLH1) (Probable WRKY transcription factor 52) (Protein RPS4-homolog) (Protein SENSITIVE TO LOW HUMIDITY 1) (Resistance to Colletotrichum higginsianum 2 protein) (Resistance to Ralstonia solanacearum 1 protein) (WRKY DNA-binding protein 52)
[RACK1 GNB2L1 HLC7 PIG21] Receptor of activated protein C kinase 1 (Cell proliferation-inducing gene 21 protein) (Guanine nucleotide-binding protein subunit beta-2-like 1) (Guanine nucleotide-binding protein subunit beta-like protein 12.3) (Human lung cancer oncogene 7 protein) (HLC-7) (Receptor for activated C kinase) (Small ribosomal subunit protein RACK1) [Cleaved into: Receptor of activated protein C kinase 1, N-terminally processed (Guanine nucleotide-binding protein subunit beta-2-like 1, N-terminally processed)]
[BRCA2 FACD FANCD1] Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)
[APEX1 APE APE1 APEX APX HAP1 REF1] DNA-(apurinic or apyrimidinic site) lyase (EC 3.1.-.-) (EC 4.2.99.18) (APEX nuclease) (APEN) (Apurinic-apyrimidinic endonuclease 1) (AP endonuclease 1) (APE-1) (REF-1) (Redox factor-1) [Cleaved into: DNA-(apurinic or apyrimidinic site) lyase, mitochondrial]
[HMGB1 HMG1] High mobility group protein B1 (High mobility group protein 1) (HMG-1)
[ERECTA ER QRP1 QRS1 TE1 At2g26330 T1D16.3] LRR receptor-like serine/threonine-protein kinase ERECTA (EC 2.7.11.1) (Protein QUANTITATIVE RESISTANCE TO PLECTOSPHAERELLA 1) (Protein QUANTITATIVE RESISTANCE TO RALSTONIA SOLANACEARUM 1) (Protein TRANSPIRATION EFFICIENCY 1)
[RRS1 RCH2 RRS1-R RSH4 SLH1 WRKY52] Disease resistance protein RRS1 (Disease resistance protein RCH2) (Disease resistance protein SLH1) (Probable WRKY transcription factor 52) (Protein RPS4-homolog) (Protein SENSITIVE TO LOW HUMIDITY 1) (Resistance to Colletotrichum higginsianum 2 protein) (Resistance to Ralstonia solanacearum 1 protein) (WRKY DNA-binding protein 52)
[KDM5B JARID1B PLU1 RBBP2H1] Lysine-specific demethylase 5B (EC 1.14.11.-) (Cancer/testis antigen 31) (CT31) (Histone demethylase JARID1B) (Jumonji/ARID domain-containing protein 1B) (PLU-1) (Retinoblastoma-binding protein 2 homolog 1) (RBP2-H1)
[MUC1 PUM] Mucin-1 (MUC-1) (Breast carcinoma-associated antigen DF3) (Cancer antigen 15-3) (CA 15-3) (Carcinoma-associated mucin) (Episialin) (H23AG) (Krebs von den Lungen-6) (KL-6) (PEMT) (Peanut-reactive urinary mucin) (PUM) (Polymorphic epithelial mucin) (PEM) (Tumor-associated epithelial membrane antigen) (EMA) (Tumor-associated mucin) (CD antigen CD227) [Cleaved into: Mucin-1 subunit alpha (MUC1-NT) (MUC1-alpha); Mucin-1 subunit beta (MUC1-beta) (MUC1-CT)]
[Brca2 Fancd1] Breast cancer type 2 susceptibility protein homolog (Fanconi anemia group D1 protein homolog)
[STEAP2 PCANAP1 STAMP1 UNQ6507/PRO23203] Metalloreductase STEAP2 (EC 1.16.1.-) (Prostate cancer-associated protein 1) (Protein up-regulated in metastatic prostate cancer) (PUMPCn) (Six-transmembrane epithelial antigen of prostate 2) (SixTransMembrane protein of prostate 1)
[NCOA6 AIB3 KIAA0181 RAP250 TRBP] Nuclear receptor coactivator 6 (Activating signal cointegrator 2) (ASC-2) (Amplified in breast cancer protein 3) (Cancer-amplified transcriptional coactivator ASC-2) (Nuclear receptor coactivator RAP250) (NRC RAP250) (Nuclear receptor-activating protein, 250 kDa) (Peroxisome proliferator-activated receptor-interacting protein) (PPAR-interacting protein) (PRIP) (Thyroid hormone receptor-binding protein)
[NCOA3 AIB1 BHLHE42 RAC3 TRAM1] Nuclear receptor coactivator 3 (NCoA-3) (EC 2.3.1.48) (ACTR) (Amplified in breast cancer 1 protein) (AIB-1) (CBP-interacting protein) (pCIP) (Class E basic helix-loop-helix protein 42) (bHLHe42) (Receptor-associated coactivator 3) (RAC-3) (Steroid receptor coactivator protein 3) (SRC-3) (Thyroid hormone receptor activator molecule 1) (TRAM-1)

Bibliography :
?>