GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Protein YIPF7 (Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9) (YIP1 family member 7)

 YIPF7_HUMAN             Reviewed;         280 AA.
Q8N8F6; Q3SY21; Q3SY22;
20-MAY-2008, integrated into UniProtKB/Swiss-Prot.
20-MAY-2008, sequence version 2.
08-MAY-2019, entry version 108.
RecName: Full=Protein YIPF7;
AltName: Full=Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9;
AltName: Full=YIP1 family member 7;
Name=YIPF7; Synonyms=FINGER9, YIP1B;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), AND VARIANT
THR-54.
TISSUE=Skeletal muscle;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
SUBCELLULAR LOCATION, AND TOPOLOGY.
PubMed=27999994; DOI=10.1007/s00418-016-1527-3;
Kranjc T., Dempsey E., Cagney G., Nakamura N., Shields D.C.,
Simpson J.C.;
"Functional characterisation of the YIPF protein family in mammalian
cells.";
Histochem. Cell Biol. 147:439-451(2017).
-!- SUBCELLULAR LOCATION: Endoplasmic reticulum membrane
{ECO:0000250|UniProtKB:Q9JIM5}; Multi-pass membrane protein. Golgi
apparatus, cis-Golgi network membrane
{ECO:0000269|PubMed:27999994}. Golgi apparatus, trans-Golgi
network membrane {ECO:0000269|PubMed:27999994}. Note=Evenly
distributed between cis- and trans-Golgi apparatus.
{ECO:0000269|PubMed:27999994}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q8N8F6-1; Sequence=Displayed;
Name=2;
IsoId=Q8N8F6-2; Sequence=VSP_033435;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q8N8F6-3; Sequence=VSP_033431, VSP_033432;
Note=No experimental confirmation available.;
Name=4;
IsoId=Q8N8F6-4; Sequence=VSP_033433, VSP_033434;
Note=No experimental confirmation available.;
-!- SIMILARITY: Belongs to the YIP1 family. {ECO:0000305}.
-!- CAUTION: It is uncertain whether Met-1 or Met-25 is the initiator.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AK096895; BAC04887.1; -; mRNA.
EMBL; AC093852; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC096586; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC108478; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC103995; AAI03996.1; -; mRNA.
EMBL; BC103996; AAI03997.1; -; mRNA.
CCDS; CCDS54766.1; -. [Q8N8F6-1]
RefSeq; NP_872398.2; NM_182592.2. [Q8N8F6-1]
STRING; 9606.ENSP00000332772; -.
iPTMnet; Q8N8F6; -.
PhosphoSitePlus; Q8N8F6; -.
BioMuta; YIPF7; -.
DMDM; 189030344; -.
PaxDb; Q8N8F6; -.
PeptideAtlas; Q8N8F6; -.
PRIDE; Q8N8F6; -.
ProteomicsDB; 72414; -.
ProteomicsDB; 72415; -. [Q8N8F6-2]
ProteomicsDB; 72416; -. [Q8N8F6-3]
ProteomicsDB; 72417; -. [Q8N8F6-4]
Ensembl; ENST00000332990; ENSP00000332772; ENSG00000177752. [Q8N8F6-1]
GeneID; 285525; -.
KEGG; hsa:285525; -.
UCSC; uc062wht.1; human. [Q8N8F6-1]
CTD; 285525; -.
GeneCards; YIPF7; -.
H-InvDB; HIX0004184; -.
HGNC; HGNC:26825; YIPF7.
HPA; HPA030642; -.
neXtProt; NX_Q8N8F6; -.
PharmGKB; PA142670550; -.
eggNOG; KOG3103; Eukaryota.
eggNOG; COG5080; LUCA.
GeneTree; ENSGT00940000153168; -.
HOGENOM; HOG000037706; -.
InParanoid; Q8N8F6; -.
KO; K20363; -.
OMA; LWCTYSA; -.
OrthoDB; 1457080at2759; -.
PhylomeDB; Q8N8F6; -.
TreeFam; TF313100; -.
ChiTaRS; YIPF7; human.
GenomeRNAi; 285525; -.
PRO; PR:Q8N8F6; -.
Proteomes; UP000005640; Chromosome 4.
Bgee; ENSG00000177752; Expressed in 75 organ(s), highest expression level in quadriceps femoris.
ExpressionAtlas; Q8N8F6; baseline and differential.
GO; GO:0005789; C:endoplasmic reticulum membrane; IEA:UniProtKB-SubCell.
GO; GO:0005794; C:Golgi apparatus; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
InterPro; IPR006977; Yip1.
Pfam; PF04893; Yip1; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Endoplasmic reticulum;
Golgi apparatus; Membrane; Polymorphism; Reference proteome;
Transmembrane; Transmembrane helix.
CHAIN 1 280 Protein YIPF7.
/FTId=PRO_0000333007.
TOPO_DOM 1 149 Cytoplasmic.
{ECO:0000305|PubMed:27999994}.
TRANSMEM 150 170 Helical. {ECO:0000255}.
TOPO_DOM 171 171 Extracellular. {ECO:0000305}.
TRANSMEM 172 192 Helical. {ECO:0000255}.
TOPO_DOM 193 196 Cytoplasmic. {ECO:0000305}.
TRANSMEM 197 217 Helical. {ECO:0000255}.
TOPO_DOM 218 220 Extracellular. {ECO:0000305}.
TRANSMEM 221 241 Helical. {ECO:0000255}.
TOPO_DOM 242 259 Cytoplasmic. {ECO:0000305}.
TRANSMEM 260 280 Helical. {ECO:0000255}.
VAR_SEQ 64 68 QQAGE -> TWNPF (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_033431.
VAR_SEQ 69 280 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_033432.
VAR_SEQ 118 132 ELGIHFDHIWQKTLT -> DKNLESILITYGKKL (in
isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_033433.
VAR_SEQ 133 280 Missing (in isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_033434.
VAR_SEQ 167 280 AGKVQFGYVYGMSAIGCLVIHALLNLMSSSGVSYGCVASVL
GYCLLPMVILSGCAMFFSLQGIFGIMSSLVIIGWCSLSASK
IFIAALHMEGQQLLVAYPCAILYGLFALLTIF -> VMCHR
KHQILMLVLSSAGFEAICINIRETVSPYIVNFLSERE (in
isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_033435.
VARIANT 54 54 A -> T (in dbSNP:rs2348353).
{ECO:0000269|PubMed:14702039}.
/FTId=VAR_043036.
CONFLICT 50 50 N -> D (in Ref. 1; BAC04887).
{ECO:0000305}.
CONFLICT 138 138 K -> E (in Ref. 1; BAC04887).
{ECO:0000305}.
SEQUENCE 280 AA; 30632 MW; AF30804CB8B3FB36 CRC64;
MDLLKISHTK LHLLEDLSIK NKQRMSNLAQ FDSDFYQSNF TIDNQEQSGN DSNAYGNLYG
SRKQQAGEQP QPASFVPSEM LMSSGYAGQF FQPASNSDYY SQSPYIDSFD EEPPLLEELG
IHFDHIWQKT LTVLNPMKPV DGSIMNETDL TGPILFCVAL GATLLLAGKV QFGYVYGMSA
IGCLVIHALL NLMSSSGVSY GCVASVLGYC LLPMVILSGC AMFFSLQGIF GIMSSLVIIG
WCSLSASKIF IAALHMEGQQ LLVAYPCAIL YGLFALLTIF


Related products :

Catalog number Product name Quantity
EIAAB46674 FINGER9,Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9,Homo sapiens,Human,Protein YIPF7,YIP1 family member 7,YIP1B,YIPF7
EIAAB46667 FINGER5,Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5,Homo sapiens,Human,PP12723,Protein YIPF5,SB140,SMAP-5,Smooth muscle cell-associated protein 5,
EIAAB46673 Bos taurus,Bovine,Protein YIPF7,YIP1 family member 7,YIPF7
EIAAB46672 Mouse,Mus musculus,Protein YIPF7,YIP1 family member 7,Yip1b,Yipf7
25-174 BLZF1 is required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface. 0.05 mg
28-853 BLZF1 is required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface. 0.05 mg
28-852 BLZF1 is required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface. 0.1 mg
YIPF7 YIPF7 Gene Yip1 domain family, member 7
30-581 SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is me 0.05 mg
26-482 SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is me 0.05 mg
26-145 NDST3 is a member of the heparan sulfate_heparin GlcNAc N-deacetylase_ N-sulfotransferase family. NDST3 is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctio 0.05 mg
26-447 RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on th 0.05 mg
orb61313 Brefeldin A1 Specifically and reversibly blocks translocation of proteins from the endoplasmic reticulum to the Golgi apparatus. For research use only. 10 mg
201-20-6459 YIPF7{Yip1 domain family, member 7}rabbit.pAb 0.2ml
26-446 ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family. Atlastin GTPases are required for Golgi apparatus and ER morphogenesis. 0.05 mg
30-241 The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC6 0.1 mg
EIAAB44606 Endoplasmic reticulum resident protein 18,Endoplasmic reticulum resident protein 19,ER protein 18,ER protein 19,ERp18,ERp19,Homo sapiens,hTLP19,Human,Thioredoxin domain-containing protein 12,Thioredox
EIAAB13222 Endoplasmic reticulum-Golgi intermediate compartment protein 1,ERGIC1,ERGIC32,ERGIC-32,ER-Golgi intermediate compartment 32 kDa protein,Homo sapiens,HT034,Human,KIAA1181
E1497b ELISA 58 kDa glucose-regulated protein,58 kDa microsomal protein,Bos taurus,Bovine,Disulfide isomerase ER-60,Endoplasmic reticulum resident protein 57,Endoplasmic reticulum resident protein 60,ER prot 96T
U1497b CLIA 58 kDa glucose-regulated protein,58 kDa microsomal protein,Bos taurus,Bovine,Disulfide isomerase ER-60,Endoplasmic reticulum resident protein 57,Endoplasmic reticulum resident protein 60,ER prote 96T
EIAAB13221 Endoplasmic reticulum-Golgi intermediate compartment protein 1,Ergic1,Ergic32,ERGIC-32,ER-Golgi intermediate compartment 32 kDa protein,Mouse,Mus musculus
U1497m CLIA 58 kDa glucose-regulated protein,58 kDa microsomal protein,Disulfide isomerase ER-60,Endoplasmic reticulum resident protein 57,Endoplasmic reticulum resident protein 60,ER protein 57,ER protein 6 96T
U1497h CLIA 58 kDa glucose-regulated protein,58 kDa microsomal protein,Disulfide isomerase ER-60,Endoplasmic reticulum resident protein 57,Endoplasmic reticulum resident protein 60,ER protein 57,ER protein 6 96T
U1497r CLIA 58 kDa glucose-regulated protein,58 kDa microsomal protein,Disulfide isomerase ER-60,Endoplasmic reticulum resident protein 57,Endoplasmic reticulum resident protein 60,ER protein 57,ER protein 6 96T
E1497r ELISA 58 kDa glucose-regulated protein,58 kDa microsomal protein,Disulfide isomerase ER-60,Endoplasmic reticulum resident protein 57,Endoplasmic reticulum resident protein 60,ER protein 57,ER protein 96T
Pathways :
WP1665: Limonene and pinene degradation
WP1675: Nitrogen metabolism
WP1685: Peptidoglycan biosynthesis
WP1714: Tyrosine metabolism
WP1909: Signal regulatory protein (SIRP) family interactions
WP1616: ABC transporters
WP1700: Selenoamino acid metabolism
WP1659: Glycine, serine and threonine metabolism
WP2203: TSLP Signaling Pathway
WP2292: Chemokine signaling pathway
WP1531: Vitamin D synthesis
WP1888: Post-translational protein modification
WP2371: Parkinsons Disease Pathway
WP525: Mitochondrial Unfolded-Protein Response
WP1625: Base excision repair
WP2032: TSH signaling pathway
WP1049: G Protein Signaling Pathways
WP1690: Propanoate metabolism
WP813: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1694: Pyrimidine metabolism
WP1657: Glycerolipid metabolism
WP2199: Seed Development
WP1663: Homologous recombination
WP2272: Pathogenic Escherichia coli infection

Related Genes :
[YIPF5 FINGER5 YIP1A PP12723 SB140 UNQ3123/PRO10275] Protein YIPF5 (Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5) (Smooth muscle cell-associated protein 5) (SMAP-5) (YIP1 family member 5) (YPT-interacting protein 1 A)
[YIPF7 FINGER9 YIP1B] Protein YIPF7 (Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9) (YIP1 family member 7)
[YIPF3 C6orf109 KLIP1] Protein YIPF3 (Killer lineage protein 1) (Natural killer cell-specific antigen KLIP1) (YIP1 family member 3) [Cleaved into: Protein YIPF3, 36 kDa form III]
[YIPF6] Protein YIPF6 (YIP1 family member 6)
[Yipf5 Yip1a] Protein YIPF5 (YIP1 family member 5) (YPT-interacting protein 1 A)
[MAN1B1 UNQ747/PRO1477] Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase (EC 3.2.1.113) (ER alpha-1,2-mannosidase) (ER mannosidase 1) (ERMan1) (Man9GlcNAc2-specific-processing alpha-mannosidase) (Mannosidase alpha class 1B member 1)
[ERGIC1 ERGIC32 KIAA1181 HT034] Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ER-Golgi intermediate compartment 32 kDa protein) (ERGIC-32)
[HSPA5 GRP78] Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein)
[Hspa5 Grp78] Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein)
[Hspa5 Grp78] Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) (Steroidogenesis-activator polypeptide)
[HSPA5 GRP78] Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein)
[Dnajc10 Erdj5 Jpdi] DnaJ homolog subfamily C member 10 (EC 1.8.4.-) (Endoplasmic reticulum DNA J domain-containing protein 5) (ER-resident protein ERdj5) (ERdj5) (Endoplasmic reticulum DnaJ-PDI fusion protein 1) (J domain-containing protein disulfide isomerase-like protein) (J domain-containing PDI-like protein) (JPDI)
[Tmem173 Eris Mita Mpys Sting] Stimulator of interferon genes protein (mSTING) (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (MMITA) (Transmembrane protein 173)
[DNAJB11 EDJ ERJ3 HDJ9 PSEC0121 UNQ537/PRO1080] DnaJ homolog subfamily B member 11 (APOBEC1-binding protein 2) (ABBP-2) (DnaJ protein homolog 9) (ER-associated DNAJ) (ER-associated Hsp40 co-chaperone) (Endoplasmic reticulum DNA J domain-containing protein 3) (ER-resident protein ERdj3) (ERdj3) (ERj3p) (HEDJ) (Human DnaJ protein 9) (hDj-9) (PWP1-interacting protein 4)
[HSPA5 GRP78 I79_019946] Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein)
[TMEM173 ERIS MITA STING] Stimulator of interferon genes protein (hSTING) (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (hMITA) (Transmembrane protein 173)
[Yipf6] Protein YIPF6 (YIP1 family member 6)
[HSPA5 GRP78] Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) (Fragment)
[HSPA5 GRP78] Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein)
[HSPA5 GRP78] Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein)
[ATP2A1] Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (SERCA1) (SR Ca(2+)-ATPase 1) (EC 7.2.2.10) (Calcium pump 1) (Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase)
[VCP] Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP)
[ATP2A2 ATP2B] Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR Ca(2+)-ATPase 2) (EC 7.2.2.10) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase)
[HSD17B10 ERAB HADH2 MRPP2 SCHAD SDR5C1 XH98G2] 3-hydroxyacyl-CoA dehydrogenase type-2 (EC 1.1.1.35) (17-beta-hydroxysteroid dehydrogenase 10) (17-beta-HSD 10) (EC 1.1.1.51) (2-methyl-3-hydroxybutyryl-CoA dehydrogenase) (MHBD) (3-hydroxy-2-methylbutyryl-CoA dehydrogenase) (EC 1.1.1.178) (3-hydroxyacyl-CoA dehydrogenase type II) (Endoplasmic reticulum-associated amyloid beta-peptide-binding protein) (Mitochondrial ribonuclease P protein 2) (Mitochondrial RNase P protein 2) (Short chain dehydrogenase/reductase family 5C member 1) (Short-chain type dehydrogenase/reductase XH98G2) (Type II HADH)
[Gosr1 Gs28] Golgi SNAP receptor complex member 1 (28 kDa Golgi SNARE protein) (28 kDa cis-Golgi SNARE p28) (GOS-28) (GOS28)
[RSAD2 CIG5] Radical S-adenosyl methionine domain-containing protein 2 (Cytomegalovirus-induced gene 5 protein) (Viperin) (Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible)
[Yipf5 Yip1a] Protein YIPF5 (YIP1 family member 5) (YPT-interacting protein 1 A)
[DNAJC10 ERDJ5 UNQ495/PRO1012] DnaJ homolog subfamily C member 10 (EC 1.8.4.-) (Endoplasmic reticulum DNA J domain-containing protein 5) (ER-resident protein ERdj5) (ERdj5) (Macrothioredoxin) (MTHr)
[CFTR ABCC7] Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)
[GOS1 YHL031C] Golgi SNAP receptor complex member 1 (Golgi SNARE protein 1) (Protein transport protein GOS1)

Bibliography :