GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Protein transport protein Sec16B (Leucine zipper transcription regulator 2) (Regucalcin gene promoter region-related protein p117) (RGPR-p117) (SEC16 homolog B)

 SC16B_HUMAN             Reviewed;        1060 AA.
Q96JE7; A3EYF1; Q5HYF6; Q8N7D6; Q96GX6;
01-JUL-2008, integrated into UniProtKB/Swiss-Prot.
01-JUL-2008, sequence version 2.
07-APR-2021, entry version 128.
RecName: Full=Protein transport protein Sec16B;
AltName: Full=Leucine zipper transcription regulator 2;
AltName: Full=Regucalcin gene promoter region-related protein p117;
Short=RGPR-p117;
AltName: Full=SEC16 homolog B;
Name=SEC16B; Synonyms=KIAA1928, LZTR2, RGPR, SEC16S;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANT ARG-730.
TISSUE=Liver;
PubMed=11605020; DOI=10.3892/ijmm.8.5.513;
Misawa H., Yamaguchi M.;
"Molecular cloning and sequencing of the cDNA coding for a novel regucalcin
gene promoter region-related protein in rat, mouse and human liver.";
Int. J. Mol. Med. 8:513-520(2001).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-292, FUNCTION, SUBUNIT,
SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
TISSUE=Liver;
PubMed=17192411; DOI=10.1091/mbc.e06-08-0707;
Bhattacharyya D., Glick B.S.;
"Two mammalian Sec16 homologues have nonredundant functions in endoplasmic
reticulum (ER) export and transitional ER organization.";
Mol. Biol. Cell 18:839-849(2007).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Testis;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANTS HIS-845;
ALA-864 AND ASN-873.
TISSUE=Retina;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D.,
Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A.,
Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), AND VARIANT ARG-292.
TISSUE=Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
TISSUE SPECIFICITY.
PubMed=12244571; DOI=10.1002/jcb.10289;
Misawa H., Yamaguchi M.;
"Gene expression for a novel protein RGPR-p117 in various species: the
stimulation by intracellular signaling factors.";
J. Cell. Biochem. 87:188-193(2002).
[7]
INTERACTION WITH TFG, AND SUBCELLULAR LOCATION.
PubMed=21478858; DOI=10.1038/ncb2225;
Witte K., Schuh A.L., Hegermann J., Sarkeshik A., Mayers J.R., Schwarze K.,
Yates J.R. III, Eimer S., Audhya A.;
"TFG-1 function in protein secretion and oncogenesis.";
Nat. Cell Biol. 13:550-558(2011).
[8]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=21768384; DOI=10.1073/pnas.1103283108;
Yonekawa S., Furuno A., Baba T., Fujiki Y., Ogasawara Y., Yamamoto A.,
Tagaya M., Tani K.;
"Sec16B is involved in the endoplasmic reticulum export of the peroxisomal
membrane biogenesis factor peroxin 16 (Pex16) in mammalian cells.";
Proc. Natl. Acad. Sci. U.S.A. 108:12746-12751(2011).
[9]
FUNCTION, SUBCELLULAR LOCATION, AND INTERACTION WITH SEC16A AND SEC13.
PubMed=22355596; DOI=10.1038/srep00077;
Budnik A., Heesom K.J., Stephens D.J.;
"Characterization of human Sec16B: indications of specialized, non-
redundant functions.";
Sci. Rep. 1:77-77(2011).
[10]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55; SER-167; SER-254; SER-258
AND THR-858, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L.,
Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human liver
phosphoproteome.";
J. Proteomics 96:253-262(2014).
-!- FUNCTION: Plays a role in the organization of the endoplasmic reticulum
exit sites (ERES), also known as transitional endoplasmic reticulum
(tER). Required for secretory cargo traffic from the endoplasmic
reticulum to the Golgi apparatus (PubMed:17192411, PubMed:21768384,
PubMed:22355596). Involved in peroxisome biogenesis. Regulates the
transport of peroxisomal biogenesis factors PEX3 and PEX16 from the ER
to peroxisomes (PubMed:21768384). {ECO:0000269|PubMed:17192411,
ECO:0000269|PubMed:21768384, ECO:0000303|PubMed:22355596}.
-!- SUBUNIT: SEC16A and SEC16B are each present in multiple copies in a
heteromeric complex (PubMed:17192411, PubMed:22355596). Interacts with
TFG (PubMed:21478858). Interacts with SEC13 (PubMed:22355596).
{ECO:0000269|PubMed:17192411, ECO:0000269|PubMed:21478858,
ECO:0000269|PubMed:22355596}.
-!- INTERACTION:
Q96JE7-2; P55735: SEC13; NbExp=6; IntAct=EBI-10215083, EBI-1046596;
-!- SUBCELLULAR LOCATION: Endoplasmic reticulum membrane
{ECO:0000269|PubMed:21768384}; Peripheral membrane protein
{ECO:0000250}. Golgi apparatus membrane {ECO:0000250}; Peripheral
membrane protein {ECO:0000250}. Note=Localizes to endoplasmic reticulum
exit sites (ERES), also known as transitional endoplasmic reticulum
(tER). {ECO:0000269|PubMed:17192411, ECO:0000269|PubMed:21478858,
ECO:0000269|PubMed:21768384, ECO:0000269|PubMed:22355596}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q96JE7-1; Sequence=Displayed;
Name=2;
IsoId=Q96JE7-2; Sequence=VSP_034373, VSP_034374;
Name=3;
IsoId=Q96JE7-3; Sequence=VSP_034371, VSP_034372, VSP_034375,
VSP_034376;
-!- TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12244571,
ECO:0000269|PubMed:17192411}.
-!- SIMILARITY: Belongs to the SEC16 family. {ECO:0000305}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AB063357; BAB61035.1; -; mRNA.
EMBL; EF125213; ABN42197.1; -; mRNA.
EMBL; AK098627; BAC05357.1; -; mRNA.
EMBL; BX647819; CAI46016.1; -; mRNA.
EMBL; BC009106; AAH09106.1; -; mRNA.
CCDS; CCDS44281.1; -. [Q96JE7-1]
RefSeq; NP_149118.2; NM_033127.2. [Q96JE7-1]
SMR; Q96JE7; -.
BioGRID; 124624; 5.
IntAct; Q96JE7; 3.
STRING; 9606.ENSP00000308339; -.
iPTMnet; Q96JE7; -.
PhosphoSitePlus; Q96JE7; -.
BioMuta; SEC16B; -.
DMDM; 193806482; -.
MassIVE; Q96JE7; -.
PaxDb; Q96JE7; -.
PeptideAtlas; Q96JE7; -.
PRIDE; Q96JE7; -.
ProteomicsDB; 76948; -. [Q96JE7-1]
ProteomicsDB; 76949; -. [Q96JE7-2]
ProteomicsDB; 76950; -. [Q96JE7-3]
TopDownProteomics; Q96JE7-1; -. [Q96JE7-1]
Antibodypedia; 35113; 117 antibodies.
DNASU; 89866; -.
Ensembl; ENST00000308284; ENSP00000308339; ENSG00000120341. [Q96JE7-1]
GeneID; 89866; -.
KEGG; hsa:89866; -.
UCSC; uc001gli.2; human. [Q96JE7-1]
CTD; 89866; -.
DisGeNET; 89866; -.
GeneCards; SEC16B; -.
HGNC; HGNC:30301; SEC16B.
HPA; ENSG00000120341; Group enriched (intestine, liver).
MIM; 612855; gene.
neXtProt; NX_Q96JE7; -.
OpenTargets; ENSG00000120341; -.
PharmGKB; PA162402680; -.
VEuPathDB; HostDB:ENSG00000120341.18; -.
eggNOG; KOG1913; Eukaryota.
GeneTree; ENSGT00940000160138; -.
HOGENOM; CLU_010575_0_0_1; -.
InParanoid; Q96JE7; -.
OMA; FQFMSGR; -.
OrthoDB; 235062at2759; -.
PhylomeDB; Q96JE7; -.
PathwayCommons; Q96JE7; -.
Reactome; R-HSA-204005; COPII-mediated vesicle transport.
SIGNOR; Q96JE7; -.
BioGRID-ORCS; 89866; 3 hits in 979 CRISPR screens.
GeneWiki; SEC16B; -.
GenomeRNAi; 89866; -.
Pharos; Q96JE7; Tbio.
PRO; PR:Q96JE7; -.
Proteomes; UP000005640; Chromosome 1.
RNAct; Q96JE7; protein.
Bgee; ENSG00000120341; Expressed in right lobe of liver and 114 other tissues.
ExpressionAtlas; Q96JE7; baseline and differential.
Genevisible; Q96JE7; HS.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0070971; C:endoplasmic reticulum exit site; IDA:UniProtKB.
GO; GO:0005789; C:endoplasmic reticulum membrane; IEA:UniProtKB-SubCell.
GO; GO:0012507; C:ER to Golgi transport vesicle membrane; IBA:GO_Central.
GO; GO:0000139; C:Golgi membrane; IEA:UniProtKB-SubCell.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:UniProtKB.
GO; GO:0006914; P:autophagy; IEA:InterPro.
GO; GO:0048208; P:COPII vesicle coating; IBA:GO_Central.
GO; GO:0007029; P:endoplasmic reticulum organization; IDA:UniProtKB.
GO; GO:0006888; P:endoplasmic reticulum to Golgi vesicle-mediated transport; IMP:UniProtKB.
GO; GO:0007030; P:Golgi organization; IBA:GO_Central.
GO; GO:0016559; P:peroxisome fission; IMP:UniProtKB.
GO; GO:0007031; P:peroxisome organization; IDA:UniProtKB.
GO; GO:0010628; P:positive regulation of gene expression; IMP:UniProtKB.
GO; GO:0070863; P:positive regulation of protein exit from endoplasmic reticulum; IMP:UniProtKB.
GO; GO:0070973; P:protein localization to endoplasmic reticulum exit site; IBA:GO_Central.
GO; GO:0015031; P:protein transport; IEA:UniProtKB-KW.
InterPro; IPR024298; ACE1_Sec16_Sec31.
InterPro; IPR024880; Sec16.
InterPro; IPR024340; Sec16_CCD.
PANTHER; PTHR13402; PTHR13402; 1.
Pfam; PF12932; Sec16; 1.
Pfam; PF12931; Sec16_C; 1.
1: Evidence at protein level;
Alternative splicing; Endoplasmic reticulum; ER-Golgi transport;
Golgi apparatus; Membrane; Peroxisome biogenesis; Phosphoprotein;
Protein transport; Reference proteome; Transport.
CHAIN 1..1060
/note="Protein transport protein Sec16B"
/id="PRO_0000341974"
REGION 34..224
/note="Required for endoplasmic reticulum localization"
REGION 271..713
/note="Central conserved domain (CCD); required for
localization to endoplasmic reticulum exit sites"
/evidence="ECO:0000269|PubMed:21768384"
COMPBIAS 88..126
/note="Tyr-rich"
COMPBIAS 232..235
/note="Poly-Ser"
MOD_RES 55
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:24275569"
MOD_RES 143
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q75N33"
MOD_RES 167
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:24275569"
MOD_RES 188
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q91XT4"
MOD_RES 191
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q91XT4"
MOD_RES 254
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:24275569"
MOD_RES 258
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:24275569"
MOD_RES 858
/note="Phosphothreonine"
/evidence="ECO:0007744|PubMed:24275569"
MOD_RES 868
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q75N33"
MOD_RES 871
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q91XT4"
MOD_RES 874
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q91XT4"
MOD_RES 882
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q91XT4"
MOD_RES 883
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q91XT4"
VAR_SEQ 1..435
/note="Missing (in isoform 3)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_034371"
VAR_SEQ 436..515
/note="ETPAQIVEKFTRLLYYGRKKEALEWAMKNHLWGHALFLSSKMDPQTYSWVMS
GFTSTLALNDPLQTLFQLMSGRIPQAAT -> MRGFVHFHHAAYSFLPPGGILLPLHRP
SWATWLDFLILKVAVGTRLHRVPVKIKRMCVNGLCRARKHRHL (in isoform 3)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_034372"
VAR_SEQ 592..624
/note="SQEFLKFATTEAIQRTEIFEYCQMLGRPKSFIP -> RYATWEKGNSKDIFQ
GTVLALVGFYGSSFHFLM (in isoform 2)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_034373"
VAR_SEQ 625..1060
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_034374"
VAR_SEQ 942..986
/note="ETPRASSPHQAGLGLSLTPSPESPPLPDVSAFSRGRGGGEGRGSA -> VGV
KAEDPHPAGGQLRALGLEACLDQRVFPLSSAPTLVFFFLHLP (in isoform 3)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_034375"
VAR_SEQ 987..1060
/note="Missing (in isoform 3)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_034376"
VARIANT 292
/note="H -> R (in dbSNP:rs12040910)"
/evidence="ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:17192411"
/id="VAR_044130"
VARIANT 730
/note="G -> R (in dbSNP:rs943762)"
/evidence="ECO:0000269|PubMed:11605020"
/id="VAR_044131"
VARIANT 845
/note="Q -> H (in dbSNP:rs7522194)"
/evidence="ECO:0000269|PubMed:17974005"
/id="VAR_044132"
VARIANT 864
/note="P -> A (in dbSNP:rs591120)"
/evidence="ECO:0000269|PubMed:17974005"
/id="VAR_044133"
VARIANT 873
/note="S -> N (in dbSNP:rs3813649)"
/evidence="ECO:0000269|PubMed:17974005"
/id="VAR_044134"
CONFLICT 134
/note="Q -> R (in Ref. 4; CAI46016)"
/evidence="ECO:0000305"
CONFLICT 195
/note="Q -> R (in Ref. 2; ABN42197)"
/evidence="ECO:0000305"
CONFLICT 262
/note="A -> AE (in Ref. 4; CAI46016 and 5; AAH09106)"
/evidence="ECO:0000305"
CONFLICT 514
/note="A -> T (in Ref. 4; CAI46016)"
/evidence="ECO:0000305"
CONFLICT 929
/note="A -> S (in Ref. 4; CAI46016)"
/evidence="ECO:0000305"
SEQUENCE 1060 AA; 116604 MW; B1D1483EAB45E676 CRC64;
MELWAPQRLP QTRGKATAPS KDPDRGFRRD GHHRPVPHSW HNGERFHQWQ DNRGSPQPQQ
EPRADHQQQP HYASRPGDWH QPVSGVDYYE GGYRNQLYSR PGYENSYQSY QSPTMREEYA
YGSYYYHGHP QWLQEERVPR QRSPYIWHED YREQKYLDEH HYENQHSPFG TNSETHFQSN
SRNPCKDSPA SNSGQEWPGE LFPGSLLAEA QKNKPSLASE SNLLQQRESG LSSSSYELSQ
YIRDAPERDD PPASAAWSPV QADVSSAGPK APMKFYIPHV PVSFGPGGQL VHVGPSSPTD
GQAALVELHS MEVILNDSEE QEEMRSFSGP LIREDVHKVD IMTFCQQKAA QSCKSETLGS
RDSALLWQLL VLLCRQNGSM VGSDIAELLM QDCKKLEKYK RQPPVANLIN LTDEDWPVLS
SGTPNLLTGE IPPSVETPAQ IVEKFTRLLY YGRKKEALEW AMKNHLWGHA LFLSSKMDPQ
TYSWVMSGFT STLALNDPLQ TLFQLMSGRI PQAATCCGEK QWGDWRPHLA VILSNQAGDP
ELYQRAIVAI GDTLAGKGLV EAAHFCYLMA HVPFGHYTVK TDHLVLLGSS HSQEFLKFAT
TEAIQRTEIF EYCQMLGRPK SFIPSFQVYK LLYASRLADY GLVSQALHYC EAIGAAVLSQ
GESSHPVLLV ELIKLAEKLK LSDPLVLERR SGDRDLEPDW LAQLRRQLEQ KVAGDIGDPH
PTRSDISGAG GTTTENTFYQ DFSGCQGYSE APGYRSALWL TPEQTCLLQP SPQQPFPLQP
GSYPAGGGAG QTGTPRPFYS VPETHLPGTG SSVAVTEATG GTVWEEMLQT HLGPGENTVS
QETSQPPDGQ EVISKPQTPL AARPRSISES SASSAKEDEK ESSDEADKNS PRNTAQRGKL
GDGKEHTKSS GFGWFSWFRS KPTKNASPAG DEDSSDSPDS EETPRASSPH QAGLGLSLTP
SPESPPLPDV SAFSRGRGGG EGRGSASSGG AAAGAGVGGL SGPESVSFEL CSNPGVLLPP
PALKGAVPLY NPSQVPQLPT ATSLNRPNRL AQRRYPTQPC


Related products :

Catalog number Product name Quantity
EIAAB37386 Leucine zipper transcription regulator 2,Lztr2,Protein transport protein Sec16B,Rat,Rattus norvegicus,Regucalcin gene promoter region-related protein p117,Rgpr,RGPR-p117,SEC16 homolog B,Sec16b
EIAAB37387 Kiaa1928,Leucine zipper transcription regulator 2,Lztr2,Mouse,Mus musculus,Protein transport protein Sec16B,Regucalcin gene promoter region-related protein p117,Rgpr,RGPR-p117,SEC16 homolog B,Sec16b
EIAAB37388 Homo sapiens,Human,KIAA1928,Leucine zipper transcription regulator 2,LZTR2,Protein transport protein Sec16B,Regucalcin gene promoter region-related protein p117,RGPR,RGPR-p117,SEC16 homolog B,SEC16B,S
EIAAB37383 Oryctolagus cuniculus,Protein transport protein Sec16B,Rabbit,Regucalcin gene promoter region-related protein p117,RGPR,RGPR-p117,SEC16 homolog B,SEC16B
EIAAB37385 Bos taurus,Bovine,Protein transport protein Sec16B,Regucalcin gene promoter region-related protein p117,RGPR,RGPR-p117,SEC16 homolog B,SEC16B
EIAAB37384 Chicken,Gallus gallus,Protein transport protein Sec16B,Regucalcin gene promoter region-related protein p117,RGPR,RGPR-p117,SEC16 homolog B,SEC16B
EIAAB37382 Homo sapiens,Human,KIAA0310,Protein transport protein Sec16A,SEC16,SEC16 homolog A,SEC16A,SEC16L
25-090 BATF is a nuclear basic leucine zipper protein that belongs to the AP-1_ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun famil 0.05 mg
SC16B_MOUSE ELISA Kit FOR Protein transport protein Sec16B; organism: Mouse; gene name: Sec16b 96T
SC16B_HUMAN ELISA Kit FOR Protein transport protein Sec16B; organism: Human; gene name: SEC16B 96T
SEC16B SEC16B Gene SEC16 homolog B (S. cerevisiae)
SC16B_RAT ELISA Kit FOR Protein transport protein Sec16B; organism: Rat; gene name: Sec16b 96T
EIAAB41080 Dsip1,Dsipi,Gilz,Glucocorticoid-induced leucine zipper protein,Mouse,Mus musculus,Tilz3,TSC22 domain family protein 3,Tsc22d3,TSC22-related-inducible leucine zipper 3
LZTS2 LZTR1 Gene leucine-zipper-like transcription regulator 1
CSB-EL020943RB Rabbit Protein transport protein Sec16B(SEC16B) ELISA kit SpeciesRabbit 96T
CSB-EL020943BO Bovine Protein transport protein Sec16B(SEC16B) ELISA kit SpeciesBovine 96T
CSB-EL020943MO Mouse Protein transport protein Sec16B(SEC16B) ELISA kit SpeciesMouse 96T
CSB-EL020943HU Human Protein transport protein Sec16B(SEC16B) ELISA kit SpeciesHuman 96T
CSB-EL020943CH Chicken Protein transport protein Sec16B(SEC16B) ELISA kit SpeciesChicken 96T
EIAAB33319 C19orf70,Homo sapiens,Human,Protein P117,Protein QIL1,QIL1
G4287 Protein transport protein Sec16B (SEC16B), Rabbit, ELISA Kit 96T
CSB-EL020943MO Mouse Protein transport protein Sec16B(SEC16B) ELISA kit 96T
CSB-EL020943RA Rat Protein transport protein Sec16B(SEC16B) ELISA kit SpeciesRat 96T
G4286 Protein transport protein Sec16B (SEC16B), Mouse, ELISA Kit 96T
G4285 Protein transport protein Sec16B (SEC16B), Human, ELISA Kit 96T
Pathways :
WP1689: Porphyrin and chlorophyll metabolism
WP1713: Two-component system
WP2272: Pathogenic Escherichia coli infection
WP2199: Seed Development
WP1616: ABC transporters
WP731: Sterol regulatory element binding protein related
WP1502: Mitochondrial biogenesis
WP1661: Glyoxylate and dicarboxylate metabolism
WP210: Cytoplasmic Ribosomal Proteins
WP2203: TSLP Signaling Pathway
WP1672: Mismatch repair
WP1566: Citrate cycle (TCA cycle)
WP1676: Non-homologous end-joining
WP2324: AGE/RAGE pathway
WP1371: G Protein Signaling Pathways
WP1685: Peptidoglycan biosynthesis
WP1939: Unfolded Protein Response
WP1624: Bacterial secretion system
WP1650: Fluorobenzoate degradation
WP2371: Parkinsons Disease Pathway
WP1438: Influenza A virus infection
WP1692: Protein export
WP1493: Carbon assimilation C4 pathway
WP1700: Selenoamino acid metabolism
WP1659: Glycine, serine and threonine metabolism

Related Genes :
[MICOS13 C19orf70 MIC13 QIL1] MICOS complex subunit MIC13 (Protein P117)
[BATF] Basic leucine zipper transcriptional factor ATF-like (B-cell-activating transcription factor) (B-ATF) (SF-HT-activated gene 2 protein) (SFA-2)
[Tsc22d1 Kiaa1994 Tgfb1i4 Tilz1b Tsc22] TSC22 domain family protein 1 (Regulatory protein TSC-22) (TGFB-stimulated clone 22 homolog) (TSC22-related inducible leucine zipper 1b) (Transforming growth factor beta-1-induced transcript 4 protein)
[MAP3K20 MLTK ZAK HCCS4] Mitogen-activated protein kinase kinase kinase 20 (EC 2.7.11.25) (Human cervical cancer suppressor gene 4 protein) (HCCS-4) (Leucine zipper- and sterile alpha motif-containing kinase) (MLK-like mitogen-activated protein triple kinase) (Mitogen-activated protein kinase kinase kinase MLT) (Mixed lineage kinase-related kinase) (MLK-related kinase) (MRK) (Sterile alpha motif- and leucine zipper-containing kinase AZK)
[CREB3 LZIP] Cyclic AMP-responsive element-binding protein 3 (CREB-3) (cAMP-responsive element-binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP-alpha) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 (N-terminal Luman) (Transcriptionally active form)]
[HAT4 ATHB-2 At4g16780 dl4415w FCAALL.101] Homeobox-leucine zipper protein HAT4 (HD-ZIP protein ATHB-2) (Homeodomain transcription factor ATHB-2) (Homeodomain-leucine zipper protein HAT4) (HD-ZIP protein 4)
[Tsc22d3 Dsip1 Dsipi Gilz] TSC22 domain family protein 3 (Glucocorticoid-induced leucine zipper protein) (TSC22-related-inducible leucine zipper 3) (Tilz3)
[TSC22D3 DSIPI GILZ] TSC22 domain family protein 3 (DSIP-immunoreactive peptide) (Protein DIP) (hDIP) (Delta sleep-inducing peptide immunoreactor) (Glucocorticoid-induced leucine zipper protein) (GILZ) (TSC-22-like protein) (TSC-22-related protein) (TSC-22R)
[Nfe2l1 Nrf1] Endoplasmic reticulum membrane sensor NFE2L1 (Locus control region-factor 1) (LCR-F1) (Nuclear factor erythroid 2-related factor 1) (NF-E2-related factor 1) (NFE2-related factor 1) (Nuclear factor, erythroid derived 2, like 1) [Cleaved into: Transcription factor NRF1]
[NR5A2 B1F CPF FTF] Nuclear receptor subfamily 5 group A member 2 (Alpha-1-fetoprotein transcription factor) (B1-binding factor) (hB1F) (CYP7A promoter-binding factor) (Hepatocytic transcription factor) (Liver receptor homolog 1) (LRH-1)
[SMARCA4 BAF190A BRG1 SNF2B SNF2L4] Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Mitotic growth and transcription activator) (Protein BRG-1) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4)
[PSEN1 AD3 PS1 PSNL1] Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) [Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)]
[PDF2 At4g04890 T1J1.3] Homeobox-leucine zipper protein PROTODERMAL FACTOR 2 (HD-ZIP protein PDF2) (Homeodomain transcription factor PDF2)
[SMARCA2 BAF190B BRM SNF2A SNF2L2] Probable global transcription activator SNF2L2 (EC 3.6.4.-) (ATP-dependent helicase SMARCA2) (BRG1-associated factor 190B) (BAF190B) (Protein brahma homolog) (hBRM) (SNF2-alpha) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2)
[Smarca4 Baf190a Brg1 Snf2b Snf2l4] Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4)
[Smarca4 Baf190a Brg1 Snf2b Snf2l4] Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4)
[NFE2L1 HBZ17 NRF1 TCF11] Endoplasmic reticulum membrane sensor NFE2L1 (Locus control region-factor 1) (LCR-F1) (Nuclear factor erythroid 2-related factor 1) (NF-E2-related factor 1) (NFE2-related factor 1) (Nuclear factor, erythroid derived 2, like 1) (Protein NRF1, p120 form) (Transcription factor 11) (TCF-11) [Cleaved into: Transcription factor NRF1 (Protein NRF1, p110 form)]
[TRIM28 KAP1 RNF96 TIF1B] Transcription intermediary factor 1-beta (TIF1-beta) (E3 SUMO-protein ligase TRIM28) (EC 2.3.2.27) (KRAB-associated protein 1) (KAP-1) (KRAB-interacting protein 1) (KRIP-1) (Nuclear corepressor KAP-1) (RING finger protein 96) (RING-type E3 ubiquitin transferase TIF1-beta) (Tripartite motif-containing protein 28)
[Batf] Basic leucine zipper transcriptional factor ATF-like (B-cell-activating transcription factor) (B-ATF)
[COI] Cytochrome c oxidase subunit 1 (EC 7.1.1.9) (Fragment)
[ATML1 At4g21750 F17L22.210] Homeobox-leucine zipper protein MERISTEM L1 (HD-ZIP protein ATML1) (Homeodomain transcription factor ATML1)
[Nfe2] Transcription factor NF-E2 45 kDa subunit (Leucine zipper protein NF-E2) (Nuclear factor, erythroid-derived 2 45 kDa subunit) (p45 NF-E2)
[LMBR1 C7orf2 DIF14] Limb region 1 protein homolog (Differentiation-related gene 14 protein)
[] V(D)J recombination-activating protein 1 (EC 2.3.2.27) (EC 3.1.-.-) (Fragment)
[Mafb Krml Maf1] Transcription factor MafB (Maf-B) (Kreisler) (Segmentation protein Kr) (Transcription factor Maf-1) (V-maf musculoaponeurotic fibrosarcoma oncogene homolog B)
[CCDC88B BRLZ] Coiled-coil domain-containing protein 88B (Brain leucine zipper domain-containing protein) (Gipie) (Hook-related protein 3) (HkRP3)
[PARD3B ALS2CR19 PAR3B PAR3L] Partitioning defective 3 homolog B (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein) (PAR3-beta) (Partitioning defective 3-like protein) (PAR3-L protein)
[NFE2] Transcription factor NF-E2 45 kDa subunit (Leucine zipper protein NF-E2) (Nuclear factor, erythroid-derived 2 45 kDa subunit) (p45 NF-E2)
[BACH1] Transcription regulator protein BACH1 (BTB and CNC homolog 1) (HA2303)
[HAT5 ATHB-1 At3g01470 F4P13.2] Homeobox-leucine zipper protein HAT5 (HD-ZIP protein ATHB-1) (Homeodomain transcription factor ATHB-1) (Homeodomain-leucine zipper protein HAT5) (HD-ZIP protein 5)

Bibliography :
No related Items