GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Protein transport protein Sec31A (SEC31-like protein 1) (SEC31-related protein A) (Vesicle-associated protein 1)

 SC31A_RAT               Reviewed;        1249 AA.
Q9Z2Q1; Q5RKK4;
10-JUL-2007, integrated into UniProtKB/Swiss-Prot.
10-JUL-2007, sequence version 2.
07-APR-2021, entry version 132.
RecName: Full=Protein transport protein Sec31A;
AltName: Full=SEC31-like protein 1;
AltName: Full=SEC31-related protein A;
AltName: Full=Vesicle-associated protein 1;
Name=Sec31a; Synonyms=Sec31l1, Vap1;
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), IDENTIFICATION BY MASS
SPECTROMETRY, TISSUE SPECIFICITY, INTERACTION WITH SEC13, AND SUBCELLULAR
LOCATION.
TISSUE=Liver;
PubMed=10574704;
Shugrue C.A., Kolen E.R., Peters H., Czernik A., Kaiser C., Matovcik L.,
Hubbard A.L., Gorelick F.;
"Identification of the putative mammalian orthologue of Sec31P, a component
of the COPII coat.";
J. Cell Sci. 112:4547-4556(1999).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Kidney;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[3]
FUNCTION, SUBCELLULAR LOCATION, AND INTERACTION WITH SEC13.
PubMed=10788476; DOI=10.1074/jbc.275.18.13597;
Tang B.L., Zhang T., Low D.Y.H., Wong E.T., Horstmann H., Hong W.;
"Mammalian homologues of yeast sec31p. An ubiquitously expressed form is
localized to endoplasmic reticulum (ER) exit sites and is essential for ER-
Golgi transport.";
J. Biol. Chem. 275:13597-13604(2000).
[4]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-526 AND SER-531, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=16396499; DOI=10.1021/pr0503073;
Moser K., White F.M.;
"Phosphoproteomic analysis of rat liver by high capacity IMAC and LC-
MS/MS.";
J. Proteome Res. 5:98-104(2006).
[5]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-526; SER-531 AND SER-1192,
AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=22673903; DOI=10.1038/ncomms1871;
Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C.,
Olsen J.V.;
"Quantitative maps of protein phosphorylation sites across 14 different rat
organs and tissues.";
Nat. Commun. 3:876-876(2012).
-!- FUNCTION: Component of the coat protein complex II (COPII) which
promotes the formation of transport vesicles from the endoplasmic
reticulum (ER). The coat has two main functions, the physical
deformation of the endoplasmic reticulum membrane into vesicles and the
selection of cargo molecules. {ECO:0000269|PubMed:10788476}.
-!- SUBUNIT: COPII is composed of at least 5 proteins: the SEC23/24
complex, the SEC13/31 complex and SAR1. SEC13 and SEC31 make a 2:2
tetramer that forms the edge element of the COPII outer coat. The
tetramer self-assembles in multiple copies to form the complete
polyhedral cage. Interacts (via WD 8) with SEC13 (PubMed:10574704,
PubMed:10788476). Interacts with PDCD6; interaction takes place in
response to cytosolic calcium increase and leads to bridge together the
BCR(KLHL12) complex and SEC31A, leading to monoubiquitination.
Interacts with KLHL12 (By similarity). {ECO:0000250,
ECO:0000250|UniProtKB:O94979, ECO:0000269|PubMed:10574704,
ECO:0000269|PubMed:10788476}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10574704}.
Cytoplasmic vesicle, COPII-coated vesicle membrane
{ECO:0000269|PubMed:10574704}; Peripheral membrane protein; Cytoplasmic
side. Endoplasmic reticulum membrane {ECO:0000269|PubMed:10574704};
Peripheral membrane protein. Note=Associates with membranes in a GTP-
dependent manner (PubMed:10574704). Localizes to endoplasmic reticulum
exit sites (ERES), also known as transitional endoplasmic reticulum
(tER) (By similarity). {ECO:0000250|UniProtKB:Q3UPL0,
ECO:0000269|PubMed:10574704}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9Z2Q1-1; Sequence=Displayed;
Name=2;
IsoId=Q9Z2Q1-2; Sequence=VSP_026754, VSP_026755, VSP_026756;
-!- TISSUE SPECIFICITY: Ubiquitously expressed.
{ECO:0000269|PubMed:10574704}.
-!- DOMAIN: The ALG-2-binding site motif-2 (ABS-2) contains a PXPGF
sequence that binds hydrophobic pocket 3 of PDCD6.
{ECO:0000250|UniProtKB:O94979}.
-!- PTM: Monoubiquitinated by the BCR(KLHL12) E3 ubiquitin ligase complex,
leading to regulate the size of COPII coats.
{ECO:0000250|UniProtKB:O94979}.
-!- SIMILARITY: Belongs to the WD repeat SEC31 family. {ECO:0000305}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AF034582; AAD01990.1; -; mRNA.
EMBL; BC085722; AAH85722.1; -; mRNA.
PIR; T14150; T14150.
RefSeq; NP_148981.1; NM_033021.1.
RefSeq; XP_006250751.1; XM_006250689.3. [Q9Z2Q1-2]
RefSeq; XP_006250752.1; XM_006250690.2. [Q9Z2Q1-2]
BioGRID; 250159; 4.
IntAct; Q9Z2Q1; 2.
STRING; 10116.ENSRNOP00000003072; -.
iPTMnet; Q9Z2Q1; -.
PhosphoSitePlus; Q9Z2Q1; -.
jPOST; Q9Z2Q1; -.
PaxDb; Q9Z2Q1; -.
PRIDE; Q9Z2Q1; -.
Ensembl; ENSRNOT00000033489; ENSRNOP00000038196; ENSRNOG00000002251. [Q9Z2Q1-2]
GeneID; 93646; -.
KEGG; rno:93646; -.
CTD; 22872; -.
RGD; 620233; Sec31a.
eggNOG; KOG0307; Eukaryota.
GeneTree; ENSGT00390000003175; -.
HOGENOM; CLU_003033_1_0_1; -.
InParanoid; Q9Z2Q1; -.
OrthoDB; 100998at2759; -.
PhylomeDB; Q9Z2Q1; -.
Reactome; R-RNO-204005; COPII-mediated vesicle transport.
Reactome; R-RNO-2132295; MHC class II antigen presentation.
Reactome; R-RNO-983170; Antigen Presentation: Folding, assembly and peptide loading of class I MHC.
PRO; PR:Q9Z2Q1; -.
Proteomes; UP000002494; Chromosome 14.
Bgee; ENSRNOG00000002251; Expressed in jejunum and 21 other tissues.
ExpressionAtlas; Q9Z2Q1; baseline and differential.
Genevisible; Q9Z2Q1; RN.
GO; GO:0030127; C:COPII vesicle coat; ISS:UniProtKB.
GO; GO:0030134; C:COPII-coated ER to Golgi transport vesicle; ISS:UniProtKB.
GO; GO:0005737; C:cytoplasm; ISO:RGD.
GO; GO:0005783; C:endoplasmic reticulum; ISO:RGD.
GO; GO:0070971; C:endoplasmic reticulum exit site; ISS:UniProtKB.
GO; GO:0005789; C:endoplasmic reticulum membrane; IEA:UniProtKB-SubCell.
GO; GO:0005768; C:endosome; IDA:RGD.
GO; GO:0048471; C:perinuclear region of cytoplasm; ISO:RGD.
GO; GO:0030120; C:vesicle coat; ISO:RGD.
GO; GO:0048306; F:calcium-dependent protein binding; ISO:RGD.
GO; GO:0005198; F:structural molecule activity; IBA:GO_Central.
GO; GO:0090110; P:COPII-coated vesicle cargo loading; ISO:RGD.
GO; GO:0007029; P:endoplasmic reticulum organization; IBA:GO_Central.
GO; GO:0006886; P:intracellular protein transport; IBA:GO_Central.
GO; GO:0051592; P:response to calcium ion; ISO:RGD.
Gene3D; 2.130.10.10; -; 1.
InterPro; IPR024298; ACE1_Sec16_Sec31.
InterPro; IPR040251; SEC31-like.
InterPro; IPR015943; WD40/YVTN_repeat-like_dom_sf.
InterPro; IPR001680; WD40_repeat.
InterPro; IPR017986; WD40_repeat_dom.
InterPro; IPR036322; WD40_repeat_dom_sf.
PANTHER; PTHR13923; PTHR13923; 1.
Pfam; PF12931; Sec16_C; 1.
SMART; SM00320; WD40; 6.
SUPFAM; SSF50978; SSF50978; 1.
PROSITE; PS50082; WD_REPEATS_2; 1.
PROSITE; PS50294; WD_REPEATS_REGION; 1.
1: Evidence at protein level;
Alternative splicing; Cytoplasm; Cytoplasmic vesicle;
Endoplasmic reticulum; ER-Golgi transport; Isopeptide bond; Membrane;
Methylation; Phosphoprotein; Protein transport; Reference proteome; Repeat;
Transport; Ubl conjugation; WD repeat.
CHAIN 1..1249
/note="Protein transport protein Sec31A"
/id="PRO_0000295150"
REPEAT 4..47
/note="WD 1"
REPEAT 64..111
/note="WD 2"
REPEAT 120..160
/note="WD 3"
REPEAT 166..206
/note="WD 4"
REPEAT 209..254
/note="WD 5"
REPEAT 258..298
/note="WD 6"
REPEAT 301..342
/note="WD 7"
REPEAT 397..429
/note="WD 8; interaction with SEC13"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00221"
REGION 161..470
/note="Interaction with SEC13"
/evidence="ECO:0000250|UniProtKB:O94979"
REGION 800..1142
/note="Interaction with PDCD6"
/evidence="ECO:0000250|UniProtKB:O94979"
MOTIF 873..879
/note="ALG-2-binding site motif-2 (ABS-2),"
/evidence="ECO:0000250|UniProtKB:O94979"
COMPBIAS 808..1120
/note="Pro-rich"
MOD_RES 423
/note="Asymmetric dimethylarginine"
/evidence="ECO:0000250|UniProtKB:Q3UPL0"
MOD_RES 526
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:16396499,
ECO:0007744|PubMed:22673903"
MOD_RES 531
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:16396499,
ECO:0007744|PubMed:22673903"
MOD_RES 799
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:O94979"
MOD_RES 1190
/note="Phosphothreonine"
/evidence="ECO:0000250|UniProtKB:O94979"
MOD_RES 1192
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:22673903"
CROSSLNK 647
/note="Glycyl lysine isopeptide (Lys-Gly) (interchain with
G-Cter in ubiquitin)"
/evidence="ECO:0000250|UniProtKB:O94979"
CROSSLNK 1246
/note="Glycyl lysine isopeptide (Lys-Gly) (interchain with
G-Cter in ubiquitin)"
/evidence="ECO:0000250|UniProtKB:O94979"
VAR_SEQ 503..541
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_026754"
VAR_SEQ 834..864
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_026755"
VAR_SEQ 907..1019
/note="PYQPAQQYSLGTGGSAVYRPQQPVAPPASKRYPNAPYVSPVASYSGQPHMYT
AQPASSPTSSSAPLPPPPSSGASFQHGGPGAPPSSSAYALPPGTTGTPPAASELPASQR
TG -> R (in isoform 2)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_026756"
CONFLICT 209
/note="D -> N (in Ref. 1; AAD01990)"
/evidence="ECO:0000305"
CONFLICT 213
/note="R -> W (in Ref. 1; AAD01990)"
/evidence="ECO:0000305"
CONFLICT 449
/note="Q -> E (in Ref. 1; AAD01990)"
/evidence="ECO:0000305"
CONFLICT 479
/note="N -> K (in Ref. 1; AAD01990)"
/evidence="ECO:0000305"
CONFLICT 817
/note="L -> F (in Ref. 1; AAD01990)"
/evidence="ECO:0000305"
SEQUENCE 1249 AA; 135272 MW; 8069E577903231B5 CRC64;
MKLKEIDRTA MQAWSPAQNH PIYLATGTSA QQLDATFSTN ASLEIFELDL SDPSLDMKSC
ATFSSSHRYH KLIWGPHKMD SKGDVSGVLI AGGENGNIIL YDPSKIIAGD KEVVIAQKDK
HTGPVRALDV NIFQTNLVAS GANESEIYIW DLNNFATPMT PGAKTQPPED ISCIAWNRQV
QHILASASPS GRATVWDLRK NEPIIKVSDH SNRMHCSGLA WHPDVATQMV LASEDDRLPV
VQMWDLRFAS SPLRVLENHA RGILAIAWSM ADPELLLSCG KDAKILCSNP NTGEVLYELP
TNTQWCFDIQ WCPRNPAVLS AASFDGRIRV YSIMGGSIDG LRQKQVDKLS SSFGNLDPFG
TGQPLPPLQI PQQTSQHSIV LPLKKPPKWI RRPVGASFSF GGKLVTFENV TGQPQQGAEQ
PRRQPVFISQ VVTEKDFLSR SEQLQHVVQS QGFISYCQKK IDASQTDFEK NVWSFLKVNF
EEDSRGKYLE LLGYRREDLG EKIALALNRV DGSDVALKDS DRVAQSDGEE SPAEEGQLLG
ERIKEEKQEC DFLPSAGGGT FNISVSGDID GLITRALLTG NFESAVDLCL HDNRMADAII
LAIAGGQELL AQTQKKYFAK SQSKITRLIT AVVMKNWKEI VESCDLKNWR EALAAVLTYA
KPDEFSALCD LLGARLESEG DSLLRTQACL CYICAGNVER LVACWTKAQD GSNPLSLQDL
IEKVVILRKA VQLTQALDTN TVGALLAEKM SQYANLLAAQ GSIAAALAFL PDNTNQPDIV
QLRDRLCRAQ GRSVPGQESS RSSYEGQPLP KGGPGPLAGH PQVSRVQSQQ YYPQVRIAPT
VTTWSDRTPT ALPSHPPAAC PSDTQGGNPP PPGFIMHGNV VPNSPAPLPT SPGHMHSQPP
PYPQPQPYQP AQQYSLGTGG SAVYRPQQPV APPASKRYPN APYVSPVASY SGQPHMYTAQ
PASSPTSSSA PLPPPPSSGA SFQHGGPGAP PSSSAYALPP GTTGTPPAAS ELPASQRTGP
QNGWNDPPAL NRVPKKKKLP ENFMPPVPIT SPIMNPGGDP QPQGLQQQPS ASGPRSSHAS
FPQPHLAGGQ PFHGIQQPLA QTGMPPSFSK PNTEGAPGAP IGNTIQHVQA LPTEKITKKP
IPDEHLILKT TFEDLIQRCL SSATDPQTKR KLDDASKRLE CLYDKLRDQT LSPTIISGLH
SIARSIETRN YSEGLTVHTH IVSTSNFSET SAFMPVLKVV LSQASKLGV


Related products :

Catalog number Product name Quantity
EIAAB37415 Protein transport protein Sec31A,Rat,Rattus norvegicus,Sec31a,Sec31l1,SEC31-like protein 1,SEC31-related protein A,Vap1,Vesicle-associated protein 1
EIAAB37414 ABP125,ABP130,Homo sapiens,HSPC275,HSPC334,Human,KIAA0905,Protein transport protein Sec31A,SEC31A,SEC31L1,SEC31-like protein 1,SEC31-related protein A,Web1-like protein
EIAAB37412 Mouse,Mus musculus,Protein transport protein Sec31A,Sec31a,Sec31l1,SEC31-like protein 1,SEC31-related protein A
EIAAB37413 Chicken,Gallus gallus,Protein transport protein Sec31A,RCJMB04_4i13,SEC31A,SEC31L1,SEC31-like protein 1,SEC31-related protein A
EIAAB37417 Gm341,Mouse,Mus musculus,Protein transport protein Sec31B,Sec31b,Sec31l2,SEC31-like protein 2,SEC31-related protein B
EIAAB37416 Homo sapiens,Human,Protein transport protein Sec31B,SEC31B,SEC31B-1,SEC31L2,SEC31-like protein 2,SEC31-related protein B
EIAAB37780 BCL2_adenovirus E1B 19 kDa protein-interacting protein 1,BNIP1,Homo sapiens,Human,NIP1,SEC20L,Transformation-related gene 8 protein,TRG8,TRG-8,Vesicle transport protein SEC20
SC31A_HUMAN ELISA Kit FOR Protein transport protein Sec31A; organism: Human; gene name: SEC31A 96T
SC31A_MOUSE ELISA Kit FOR Protein transport protein Sec31A; organism: Mouse; gene name: Sec31a 96T
CSB-EL020954HU Human Protein transport protein Sec31A(SEC31A) ELISA kit SpeciesHuman 96T
CSB-EL020954CH Chicken Protein transport protein Sec31A(SEC31A) ELISA kit SpeciesChicken 96T
SC31A_RAT ELISA Kit FOR Protein transport protein Sec31A; organism: Rat; gene name: Sec31a 96T
CSB-EL020954MO Mouse Protein transport protein Sec31A(SEC31A) ELISA kit SpeciesMouse 96T
SEC31A SEC31A Gene SEC31 homolog A (S. cerevisiae)
G4302 Protein transport protein Sec31A (SEC31A), Chicken, ELISA Kit 96T
CSB-EL020954CH Chicken Protein transport protein Sec31A(SEC31A) ELISA kit 96T
CSB-EL020954RA Rat Protein transport protein Sec31A(SEC31A) ELISA kit SpeciesRat 96T
G4304 Protein transport protein Sec31A (SEC31A), Mouse, ELISA Kit 96T
G4303 Protein transport protein Sec31A (SEC31A), Human, ELISA Kit 96T
CSB-EL020954HU Human Protein transport protein Sec31A(SEC31A) ELISA kit 96T
CSB-EL020954MO Mouse Protein transport protein Sec31A(SEC31A) ELISA kit 96T
EIAAB29951 Calcium transport inhibitor,Caltrin,Mouse,Mus musculus,Pate4,PATE-B,PATE-like protein B,Prostate and testis expressed protein 4,Seminal vesicle protein 7,Seminal vesicle protein VII,SVS VII,Svs7
CSB-EL020954RA Rat Protein transport protein Sec31A(SEC31A) ELISA kit 96T
G4305 Protein transport protein Sec31A (SEC31A), Rat, ELISA Kit 96T
EIAAB37533 Ra410,Rat,Rattus norvegicus,Scfd1,Sec1 family domain-containing protein 1,Sly1,SLY1 homolog,Sly1p,Stxbp1l2,Syntaxin-binding protein 1-like 2,Vesicle transport-related protein Ra410
Pathways :
WP1616: ABC transporters
WP731: Sterol regulatory element binding protein related
WP1689: Porphyrin and chlorophyll metabolism
WP2272: Pathogenic Escherichia coli infection
WP1713: Two-component system
WP1502: Mitochondrial biogenesis
WP2199: Seed Development
WP1624: Bacterial secretion system
WP1909: Signal regulatory protein (SIRP) family interactions
WP813: G Protein Signaling Pathways
WP1685: Peptidoglycan biosynthesis
WP1692: Protein export
WP232: G Protein Signaling Pathways
WP1650: Fluorobenzoate degradation
WP1659: Glycine, serine and threonine metabolism
WP1939: Unfolded Protein Response
WP1371: G Protein Signaling Pathways
WP1700: Selenoamino acid metabolism
WP525: Mitochondrial Unfolded-Protein Response
WP1665: Limonene and pinene degradation
WP2032: TSH signaling pathway
WP1675: Nitrogen metabolism
WP211: BMP signaling pathway
WP2218: sGC
WP1690: Propanoate metabolism

Related Genes :
[PEF1 ABP32 UNQ1845/PRO3573] Peflin (PEF protein with a long N-terminal hydrophobic domain) (Penta-EF hand domain-containing protein 1)
[KLHL12 C3IP1] Kelch-like protein 12 (CUL3-interacting protein 1) (DKIR homolog) (hDKIR)
[PDCD6 ALG2] Programmed cell death protein 6 (Apoptosis-linked gene 2 protein homolog) (ALG-2)
[Pdcd6 Alg2] Programmed cell death protein 6 (ALG-257) (Apoptosis-linked gene 2 protein) (ALG-2) (PMP41)
[Pdcd6 Alg2] Programmed cell death protein 6 (Apoptosis-linked gene 2 protein homolog) (ALG-2)
[Lrrk2] Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-)
[ALK] ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246)
[Pef1] Peflin (PEF protein with a long N-terminal hydrophobic domain) (Penta-EF hand domain-containing protein 1)
[CUL3 KIAA0617] Cullin-3 (CUL-3)
[Cul3] Cullin-3 (CUL-3)
[Cul3] Cullin-3
[sec31 B24N11.230 NCU06738] Protein transport protein sec31
[SEC24 ANU1 YIL109C] Protein transport protein SEC24 (Abnormal nuclear morphology 1)
[SEC13 ANU3 YLR208W L8167.4] Protein transport protein SEC13
[Pef1] Peflin (PEF protein with a long N-terminal hydrophobic domain) (Penta-EF hand domain-containing protein 1)
[sec31 DDB_G0270992] Protein transport protein SEC31
[PF3D7_0214100] Protein transport protein SEC31
[AP2A1 ADTAA CLAPA1] AP-2 complex subunit alpha-1 (100 kDa coated vesicle protein A) (Adaptor protein complex AP-2 subunit alpha-1) (Adaptor-related protein complex 2 subunit alpha-1) (Alpha-adaptin A) (Alpha1-adaptin) (Clathrin assembly protein complex 2 alpha-A large chain) (Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit)
[Ap2a1 Adtaa Clapa1] AP-2 complex subunit alpha-1 (100 kDa coated vesicle protein A) (Adaptor protein complex AP-2 subunit alpha-1) (Adaptor-related protein complex 2 subunit alpha-1) (Alpha-adaptin A) (Alpha1-adaptin) (Clathrin assembly protein complex 2 alpha-A large chain) (Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit)
[REL] Proto-oncogene c-Rel
[CCDC88A APE GRDN KIAA1212] Girdin (Akt phosphorylation enhancer) (APE) (Coiled-coil domain-containing protein 88A) (G alpha-interacting vesicle-associated protein) (GIV) (Girders of actin filament) (Hook-related protein 1) (HkRP1)
[Klhl12 C3ip1] Kelch-like protein 12 (CUL3-interacting protein 1)
[VTI11 SGR4 VTI1A ZIG ZIG1 At5g39510 MUL8_190] Vesicle transport v-SNARE 11 (AtVTI11) (Protein SHOOT GRAVITROPISM 4) (Vesicle soluble NSF attachment protein receptor VTI1a) (AtVTI1a) (Vesicle transport v-SNARE protein VTI1a)
[Vti1a Vti1 Vti1l2] Vesicle transport through interaction with t-SNAREs homolog 1A (Vesicle transport v-SNARE protein Vti1-like 2) (Vti1-rp2)
[Vti1a Vti1l2] Vesicle transport through interaction with t-SNAREs homolog 1A (Vesicle transport v-SNARE protein Vti1-like 2) (Vti1-rp2)
[VTI1A] Vesicle transport through interaction with t-SNAREs homolog 1A (Vesicle transport v-SNARE protein Vti1-like 2) (Vti1-rp2)
[npp-20 CeSec13R sec-13 Y77E11A.13] Protein SEC13 homolog (CeSEH13R) (GATOR complex protein SEC13) (Nuclear pore complex protein 20)
[] Genome polyprotein [Cleaved into: Core protein precursor (Capsid protein C) (p23); Mature core protein (p21); Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2 (p23) (EC 3.4.22.-) (Non-structural protein 2) (NS2); Serine protease/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3 helicase) (NS3 protease) (NS3P) (Viroporin p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56/58); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)]
[VTI12 VTI1B At1g26670 T24P13.5] Vesicle transport v-SNARE 12 (AtVTI12) (Vesicle soluble NSF attachment protein receptor VTI1b) (AtVTI1b) (Vesicle transport v-SNARE protein VTI1b)
[VTI1 YMR197C YM9646.10C] t-SNARE VTI1 (Qb-SNARE VTI1) (VPS10-interacting protein 1) (Vesicle transport v-SNARE protein VTI1)

Bibliography :
No related Items