GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

RUN and SH3 domain-containing protein 1 (New molecule containing SH3 at the carboxy-terminus) (Nesca)

 RUSC1_HUMAN             Reviewed;         902 AA.
Q9BVN2; B3KWM9; Q5T9U9; Q5T9V0; Q5T9V1; Q5T9V2; Q9UPY4; Q9Y4T5;
19-JUL-2004, integrated into UniProtKB/Swiss-Prot.
23-OCT-2007, sequence version 3.
17-JUN-2020, entry version 164.
RecName: Full=RUN and SH3 domain-containing protein 1;
AltName: Full=New molecule containing SH3 at the carboxy-terminus;
Short=Nesca;
Name=RUSC1; Synonyms=NESCA;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
PubMed=10760598; DOI=10.1016/s0167-4781(00)00049-x;
Matsuda S., Miyazaki K., Ichigotani Y., Kurata H., Takenouchi Y.,
Yamamoto T., Nimura Y., Irimura T., Nakatsugawa S., Hamaguchi M.;
"Molecular cloning and characterization of a novel human gene (NESCA) which
encodes a putative adapter protein containing SH3.";
Biochim. Biophys. Acta 1491:321-326(2000).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
PubMed=16303743; DOI=10.1093/dnares/12.2.117;
Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J.,
Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S.,
Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.,
Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S.,
Isogai T.;
"Signal sequence and keyword trap in silico for selection of full-length
human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA
libraries.";
DNA Res. 12:117-126(2005).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Brain, and Endometrium;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D.,
Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A.,
Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A.,
Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C.,
Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.,
Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C.,
Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W.,
Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J.,
Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J.,
Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y.,
Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J.,
Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S.,
Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K.,
Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R.,
Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M.,
Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S.,
Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J.,
Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W.,
McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S.,
Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M.,
White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H.,
Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E.,
Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G.,
Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
TISSUE=Lung, and Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
CHARACTERIZATION, AND MUTAGENESIS OF LEU-531.
PubMed=15024033; DOI=10.1083/jcb.200309081;
MacDonald J.I.S., Kubu C.J., Meakin S.O.;
"Nesca, a novel adapter, translocates to the nuclear envelope and regulates
neurotrophin-induced neurite outgrowth.";
J. Cell Biol. 164:851-862(2004).
[9]
FUNCTION, INTERACTION WITH IKBKG AND TRAF6, AND UBIQUITINATION.
PubMed=19365808; DOI=10.1002/jcp.21782;
Napolitano G., Mirra S., Monfregola J., Lavorgna A., Leonardi A.,
Ursini M.V.;
"NESCA: a new NEMO/IKKgamma and TRAF6 interacting protein.";
J. Cell. Physiol. 220:410-417(2009).
-!- FUNCTION: Putative signaling adapter which may play a role in neuronal
differentiation. May be involved in regulation of NGF-dependent neurite
outgrowth. Proposed to play a role in neuronal vesicular trafficking,
specifically involving pre-synaptic membrane proteins. Seems to be
involved in signaling pathways that are regulated by the prolonged
activation of MAPK. Can regulate the polyubiquitination of IKBKG and
thus may be involved in regulation of the NF-kappa-B pathway.
{ECO:0000269|PubMed:19365808}.
-!- SUBUNIT: Interacts with IKBKG and TRAF6. Interacts with F-actin,
acetylated actin, TUBB3, STX1A, KIF5B and KLC1 (By similarity).
{ECO:0000250}.
-!- INTERACTION:
Q9BVN2; Q8NFV4-4: ABHD11; NbExp=3; IntAct=EBI-6257312, EBI-12318443;
Q9BVN2; Q8WTS1: ABHD5; NbExp=3; IntAct=EBI-6257312, EBI-2813554;
Q9BVN2; Q9NYB9-2: ABI2; NbExp=3; IntAct=EBI-6257312, EBI-11096309;
Q9BVN2; Q9ULX6: AKAP8L; NbExp=3; IntAct=EBI-6257312, EBI-357530;
Q9BVN2; Q49AR9: ANKS1A; NbExp=3; IntAct=EBI-6257312, EBI-11954519;
Q9BVN2; Q8N8Y2: ATP6V0D2; NbExp=3; IntAct=EBI-6257312, EBI-3923949;
Q9BVN2; Q9NP55: BPIFA1; NbExp=3; IntAct=EBI-6257312, EBI-953896;
Q9BVN2; Q9NX04: C1orf109; NbExp=5; IntAct=EBI-6257312, EBI-8643161;
Q9BVN2; Q96HB5: CCDC120; NbExp=3; IntAct=EBI-6257312, EBI-744556;
Q9BVN2; Q2TAC2-2: CCDC57; NbExp=3; IntAct=EBI-6257312, EBI-10961624;
Q9BVN2; Q8TD31-3: CCHCR1; NbExp=3; IntAct=EBI-6257312, EBI-10175300;
Q9BVN2; P24863: CCNC; NbExp=3; IntAct=EBI-6257312, EBI-395261;
Q9BVN2; P42772: CDKN2B; NbExp=3; IntAct=EBI-6257312, EBI-711280;
Q9BVN2; Q9NX76: CMTM6; NbExp=3; IntAct=EBI-6257312, EBI-1054315;
Q9BVN2; Q03060-25: CREM; NbExp=3; IntAct=EBI-6257312, EBI-12884642;
Q9BVN2; P53672: CRYBA2; NbExp=3; IntAct=EBI-6257312, EBI-750444;
Q9BVN2; P78358: CTAG1A; NbExp=3; IntAct=EBI-6257312, EBI-1188472;
Q9BVN2; Q9NQL9: DMRT3; NbExp=3; IntAct=EBI-6257312, EBI-9679045;
Q9BVN2; Q6PKX4: DOK6; NbExp=3; IntAct=EBI-6257312, EBI-2880244;
Q9BVN2; Q86UW9: DTX2; NbExp=3; IntAct=EBI-6257312, EBI-740376;
Q9BVN2; Q8IYI6: EXOC8; NbExp=3; IntAct=EBI-6257312, EBI-742102;
Q9BVN2; Q96B26: EXOSC8; NbExp=6; IntAct=EBI-6257312, EBI-371922;
Q9BVN2; Q8IZU0: FAM9B; NbExp=5; IntAct=EBI-6257312, EBI-10175124;
Q9BVN2; Q53EP0-3: FNDC3B; NbExp=3; IntAct=EBI-6257312, EBI-10242151;
Q9BVN2; O75603: GCM2; NbExp=3; IntAct=EBI-6257312, EBI-10188645;
Q9BVN2; Q9NP66: HMG20A; NbExp=3; IntAct=EBI-6257312, EBI-740641;
Q9BVN2; P52597: HNRNPF; NbExp=3; IntAct=EBI-6257312, EBI-352986;
Q9BVN2; Q1MX18: INSC; NbExp=3; IntAct=EBI-6257312, EBI-12081118;
Q9BVN2; Q7L273: KCTD9; NbExp=3; IntAct=EBI-6257312, EBI-4397613;
Q9BVN2; Q8IUB9: KRTAP19-1; NbExp=3; IntAct=EBI-6257312, EBI-12811111;
Q9BVN2; Q3LI72: KRTAP19-5; NbExp=3; IntAct=EBI-6257312, EBI-1048945;
Q9BVN2; Q3LI66: KRTAP6-2; NbExp=5; IntAct=EBI-6257312, EBI-11962084;
Q9BVN2; Q8IUC2: KRTAP8-1; NbExp=3; IntAct=EBI-6257312, EBI-10261141;
Q9BVN2; P0CW20: LIMS4; NbExp=3; IntAct=EBI-6257312, EBI-10196832;
Q9BVN2; P25791-3: LMO2; NbExp=3; IntAct=EBI-6257312, EBI-11959475;
Q9BVN2; P43357: MAGEA3; NbExp=3; IntAct=EBI-6257312, EBI-5651459;
Q9BVN2; P43360: MAGEA6; NbExp=3; IntAct=EBI-6257312, EBI-1045155;
Q9BVN2; Q9Y5V3: MAGED1; NbExp=3; IntAct=EBI-6257312, EBI-716006;
Q9BVN2; Q71SY5: MED25; NbExp=3; IntAct=EBI-6257312, EBI-394558;
Q9BVN2; O14770-4: MEIS2; NbExp=3; IntAct=EBI-6257312, EBI-8025850;
Q9BVN2; Q8IVT2: MISP; NbExp=3; IntAct=EBI-6257312, EBI-2555085;
Q9BVN2; Q96BY2: MOAP1; NbExp=3; IntAct=EBI-6257312, EBI-739825;
Q9BVN2; Q6PF18: MORN3; NbExp=3; IntAct=EBI-6257312, EBI-9675802;
Q9BVN2; Q8TDC0: MYOZ3; NbExp=3; IntAct=EBI-6257312, EBI-5662487;
Q9BVN2; O15049: N4BP3; NbExp=3; IntAct=EBI-6257312, EBI-2512055;
Q9BVN2; Q9BSH3: NICN1; NbExp=3; IntAct=EBI-6257312, EBI-13324229;
Q9BVN2; Q9BRQ3: NUDT22; NbExp=4; IntAct=EBI-6257312, EBI-10297093;
Q9BVN2; O43482: OIP5; NbExp=3; IntAct=EBI-6257312, EBI-536879;
Q9BVN2; Q7Z4N8: P4HA3; NbExp=3; IntAct=EBI-6257312, EBI-10181968;
Q9BVN2; Q99471: PFDN5; NbExp=3; IntAct=EBI-6257312, EBI-357275;
Q9BVN2; Q92569: PIK3R3; NbExp=3; IntAct=EBI-6257312, EBI-79893;
Q9BVN2; O60733: PLA2G6; NbExp=3; IntAct=EBI-6257312, EBI-12089905;
Q9BVN2; Q8IYS1: PM20D2; NbExp=3; IntAct=EBI-6257312, EBI-11339910;
Q9BVN2; Q8ND90: PNMA1; NbExp=8; IntAct=EBI-6257312, EBI-302345;
Q9BVN2; O15160: POLR1C; NbExp=3; IntAct=EBI-6257312, EBI-1055079;
Q9BVN2; Q9GZV8: PRDM14; NbExp=3; IntAct=EBI-6257312, EBI-3957793;
Q9BVN2; P0CG20: PRR35; NbExp=3; IntAct=EBI-6257312, EBI-11986293;
Q9BVN2; Q93062: RBPMS; NbExp=4; IntAct=EBI-6257312, EBI-740322;
Q9BVN2; Q93062-3: RBPMS; NbExp=3; IntAct=EBI-6257312, EBI-740343;
Q9BVN2; Q12824-2: SMARCB1; NbExp=3; IntAct=EBI-6257312, EBI-358436;
Q9BVN2; Q8NB12: SMYD1; NbExp=3; IntAct=EBI-6257312, EBI-8463848;
Q9BVN2; Q5JUK2: SOHLH1; NbExp=3; IntAct=EBI-6257312, EBI-12288855;
Q9BVN2; Q99932-2: SPAG8; NbExp=3; IntAct=EBI-6257312, EBI-11959123;
Q9BVN2; Q9UNE7: STUB1; NbExp=3; IntAct=EBI-6257312, EBI-357085;
Q9BVN2; P51687: SUOX; NbExp=3; IntAct=EBI-6257312, EBI-3921347;
Q9BVN2; Q3MII6: TBC1D25; NbExp=3; IntAct=EBI-6257312, EBI-11899977;
Q9BVN2; Q9BT92: TCHP; NbExp=3; IntAct=EBI-6257312, EBI-740781;
Q9BVN2; Q8WW24: TEKT4; NbExp=5; IntAct=EBI-6257312, EBI-750487;
Q9BVN2; Q96A09: TENT5B; NbExp=3; IntAct=EBI-6257312, EBI-752030;
Q9BVN2; Q08117-2: TLE5; NbExp=3; IntAct=EBI-6257312, EBI-11741437;
Q9BVN2; O75865-2: TRAPPC6A; NbExp=3; IntAct=EBI-6257312, EBI-8451480;
Q9BVN2; Q86UV6-2: TRIM74; NbExp=3; IntAct=EBI-6257312, EBI-10259086;
Q9BVN2; Q96PN8: TSSK3; NbExp=5; IntAct=EBI-6257312, EBI-3918381;
Q9BVN2; Q6DKK2: TTC19; NbExp=3; IntAct=EBI-6257312, EBI-948354;
Q9BVN2; Q86TV6: TTC7B; NbExp=3; IntAct=EBI-6257312, EBI-12006098;
Q9BVN2; Q6NVU6: UFSP1; NbExp=3; IntAct=EBI-6257312, EBI-12068150;
Q9BVN2; A8MV65-2: VGLL3; NbExp=3; IntAct=EBI-6257312, EBI-11957216;
Q9BVN2; Q96HA8: WDYHV1; NbExp=3; IntAct=EBI-6257312, EBI-741158;
Q9BVN2; Q9NZC7-5: WWOX; NbExp=3; IntAct=EBI-6257312, EBI-12040603;
Q9BVN2; O00308: WWP2; NbExp=3; IntAct=EBI-6257312, EBI-743923;
Q9BVN2; Q15915: ZIC1; NbExp=3; IntAct=EBI-6257312, EBI-11963196;
Q9BVN2; Q9H0C1: ZMYND12; NbExp=5; IntAct=EBI-6257312, EBI-12030590;
Q9BVN2; Q6ZNG0: ZNF620; NbExp=3; IntAct=EBI-6257312, EBI-4395669;
Q9BVN2; Q7L2R6-2: ZNF765; NbExp=3; IntAct=EBI-6257312, EBI-12834294;
Q9BVN2; Q15935: ZNF77; NbExp=3; IntAct=EBI-6257312, EBI-12840750;
Q9BVN2-2; Q9Y6K9: IKBKG; NbExp=4; IntAct=EBI-6257338, EBI-81279;
Q9BVN2-2; Q9Y4K3: TRAF6; NbExp=2; IntAct=EBI-6257338, EBI-359276;
-!- SUBCELLULAR LOCATION: Cytoplasm. Nucleus. Cytoplasm, cytoskeleton
{ECO:0000250}. Cytoplasmic vesicle {ECO:0000250}. Early endosome
{ECO:0000250}. Cell junction, synapse, postsynaptic density
{ECO:0000250}. Golgi apparatus {ECO:0000250}. Note=Translocated to the
nuclear envelope upon stimulation with NGF. Associated with membranes
and microtubules (By similarity). {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q9BVN2-1; Sequence=Displayed;
Name=2;
IsoId=Q9BVN2-2; Sequence=VSP_010855;
Name=3;
IsoId=Q9BVN2-3; Sequence=VSP_054052;
Name=4;
IsoId=Q9BVN2-4; Sequence=VSP_054053;
-!- TISSUE SPECIFICITY: Predominantly expressed in brain.
-!- DOMAIN: The RUN domain is necessary for NGF induced nuclear
redistribution.
-!- PTM: Phosphorylated on serine residues following nuclear translocation.
-!- PTM: Polyubiquitinated; polyubiquitination involves TRAF6.
{ECO:0000269|PubMed:19365808}.
-!- SEQUENCE CAUTION:
Sequence=AAH52277.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};
Sequence=BAG54191.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AB026894; BAA77507.2; -; mRNA.
EMBL; AL080083; CAB45702.1; -; mRNA.
EMBL; AK314559; BAG37144.1; -; mRNA.
EMBL; AK074982; BAG52045.1; -; mRNA.
EMBL; AK055451; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AK125378; BAG54191.1; ALT_INIT; mRNA.
EMBL; BX640612; CAE45718.1; -; mRNA.
EMBL; AL139410; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471121; EAW53069.1; -; Genomic_DNA.
EMBL; CH471121; EAW53071.1; -; Genomic_DNA.
EMBL; CH471121; EAW53072.1; -; Genomic_DNA.
EMBL; BC001045; AAH01045.1; -; mRNA.
EMBL; BC025680; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; BC052277; AAH52277.1; ALT_INIT; mRNA.
CCDS; CCDS1112.1; -. [Q9BVN2-2]
CCDS; CCDS41410.1; -. [Q9BVN2-1]
CCDS; CCDS41411.1; -. [Q9BVN2-4]
CCDS; CCDS41412.1; -. [Q9BVN2-3]
PIR; T12473; T12473.
RefSeq; NP_001098673.1; NM_001105203.1. [Q9BVN2-1]
RefSeq; NP_001098674.1; NM_001105204.1. [Q9BVN2-4]
RefSeq; NP_001098675.1; NM_001105205.1. [Q9BVN2-3]
RefSeq; NP_001265156.1; NM_001278227.1.
RefSeq; NP_001265157.1; NM_001278228.1.
RefSeq; NP_001265158.1; NM_001278229.1.
RefSeq; NP_001265159.1; NM_001278230.1. [Q9BVN2-2]
RefSeq; NP_055143.2; NM_014328.4. [Q9BVN2-2]
RefSeq; XP_006711320.1; XM_006711257.1. [Q9BVN2-2]
RefSeq; XP_016856381.1; XM_017000892.1.
PDB; 4GIW; X-ray; 2.00 A; A/B=477-666.
PDBsum; 4GIW; -.
SMR; Q9BVN2; -.
BioGRID; 117155; 15.
IntAct; Q9BVN2; 101.
MINT; Q9BVN2; -.
STRING; 9606.ENSP00000357336; -.
iPTMnet; Q9BVN2; -.
PhosphoSitePlus; Q9BVN2; -.
BioMuta; RUSC1; -.
DMDM; 160380712; -.
jPOST; Q9BVN2; -.
MassIVE; Q9BVN2; -.
MaxQB; Q9BVN2; -.
PaxDb; Q9BVN2; -.
PeptideAtlas; Q9BVN2; -.
PRIDE; Q9BVN2; -.
ProteomicsDB; 64815; -.
ProteomicsDB; 79221; -. [Q9BVN2-1]
ProteomicsDB; 79222; -. [Q9BVN2-2]
Antibodypedia; 34192; 115 antibodies.
DNASU; 23623; -.
Ensembl; ENST00000292254; ENSP00000292254; ENSG00000160753. [Q9BVN2-2]
Ensembl; ENST00000368347; ENSP00000357331; ENSG00000160753. [Q9BVN2-3]
Ensembl; ENST00000368349; ENSP00000357333; ENSG00000160753. [Q9BVN2-2]
Ensembl; ENST00000368352; ENSP00000357336; ENSG00000160753. [Q9BVN2-1]
Ensembl; ENST00000368354; ENSP00000357338; ENSG00000160753. [Q9BVN2-4]
GeneID; 23623; -.
KEGG; hsa:23623; -.
UCSC; uc001fkj.3; human. [Q9BVN2-1]
CTD; 23623; -.
EuPathDB; HostDB:ENSG00000160753.15; -.
GeneCards; RUSC1; -.
HGNC; HGNC:17153; RUSC1.
HPA; ENSG00000160753; Low tissue specificity.
MIM; 617318; gene.
neXtProt; NX_Q9BVN2; -.
OpenTargets; ENSG00000160753; -.
PharmGKB; PA134947113; -.
eggNOG; KOG0711; Eukaryota.
eggNOG; COG0142; LUCA.
GeneTree; ENSGT00900000141033; -.
HOGENOM; CLU_014918_0_0_1; -.
InParanoid; Q9BVN2; -.
KO; K23283; -.
OMA; WKTNTGI; -.
OrthoDB; 373320at2759; -.
PhylomeDB; Q9BVN2; -.
TreeFam; TF332235; -.
BioGRID-ORCS; 23623; 5 hits in 791 CRISPR screens.
ChiTaRS; RUSC1; human.
GenomeRNAi; 23623; -.
Pharos; Q9BVN2; Tbio.
PRO; PR:Q9BVN2; -.
Proteomes; UP000005640; Chromosome 1.
RNAct; Q9BVN2; protein.
Bgee; ENSG00000160753; Expressed in cerebellar hemisphere and 220 other tissues.
ExpressionAtlas; Q9BVN2; baseline and differential.
Genevisible; Q9BVN2; HS.
GO; GO:0031410; C:cytoplasmic vesicle; ISS:UniProtKB.
GO; GO:0005829; C:cytosol; IDA:HPA.
GO; GO:0005769; C:early endosome; ISS:UniProtKB.
GO; GO:0005794; C:Golgi apparatus; ISS:UniProtKB.
GO; GO:0005874; C:microtubule; IEA:UniProtKB-KW.
GO; GO:0015630; C:microtubule cytoskeleton; ISS:UniProtKB.
GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
GO; GO:0014069; C:postsynaptic density; IEA:UniProtKB-SubCell.
GO; GO:0003779; F:actin binding; ISS:UniProtKB.
GO; GO:0005070; F:SH3/SH2 adaptor activity; TAS:ProtInc.
GO; GO:0000209; P:protein polyubiquitination; IDA:UniProtKB.
Gene3D; 1.20.58.900; -; 1.
InterPro; IPR004012; Run_dom.
InterPro; IPR037213; Run_dom_sf.
InterPro; IPR036028; SH3-like_dom_sf.
InterPro; IPR001452; SH3_domain.
Pfam; PF02759; RUN; 1.
Pfam; PF14604; SH3_9; 1.
SMART; SM00593; RUN; 1.
SMART; SM00326; SH3; 1.
SUPFAM; SSF140741; SSF140741; 1.
SUPFAM; SSF50044; SSF50044; 1.
PROSITE; PS50826; RUN; 1.
PROSITE; PS50002; SH3; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cell junction; Cytoplasm;
Cytoplasmic vesicle; Cytoskeleton; Endosome; Golgi apparatus; Microtubule;
Nucleus; Phosphoprotein; Polymorphism; Reference proteome; SH3 domain;
Synapse; Ubl conjugation.
CHAIN 1..902
/note="RUN and SH3 domain-containing protein 1"
/id="PRO_0000097532"
DOMAIN 522..666
/note="RUN"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00178"
DOMAIN 844..902
/note="SH3"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"
REGION 470..605
/note="Interaction with TRAF6"
/evidence="ECO:0000269|PubMed:19365808"
REGION 606..672
/note="Interaction with IKBKG"
/evidence="ECO:0000269|PubMed:19365808"
VAR_SEQ 1..469
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:10760598,
ECO:0000303|PubMed:14702039, ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:16303743, ECO:0000303|PubMed:17974005"
/id="VSP_010855"
VAR_SEQ 1..452
/note="MLSPQRALLCNLNHIHLQHVSLGLHLSRRPELQEGPLSTPPPPGDTGGKESR
GPCSGTLVDANSNSPAVPCRCCQEHGPGLENRQDPSQEEEGAASPSDPGCSSSLSSCSD
LSPDESPVSVYLRDLPGDEDAHPQPSIIPLEQGSPLASAGPGTCSPDSFCCSPDSCSGA
SSSPDPGLDSNCNALTTCQDVPSPGLEEEDERAEQDLPTSELLEADDGKIDAGKTEPSW
KINPIWKIDTEKTKAEWKTTENNNTGWKNNGNVNSSWKSEPEKFDSGWKTNTRITDSGS
KTDAGKIDGGWRSDVSEEPVPHRTITSFHELAQKRKRGPGLPLVPQAKKDRSDWLIVFS
PDTELPPSGSPGGSSAPPREVTTFKELRSRSRAPAPPVPPRDPPVGWALVPPRPPPPPV
PPRRKKNRPGLQPIAEGQSEEGRAVSPAAGEEAPAAKEPGAQAGLE -> MPPTCSPGL
RRQDWAPGRCAGLHLPPRAPSSPALQALAGQAG (in isoform 3)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_054052"
VAR_SEQ 621..726
/note="Missing (in isoform 4)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_054053"
VARIANT 362
/note="S -> F (in dbSNP:rs12061020)"
/id="VAR_036803"
VARIANT 493
/note="V -> A (in dbSNP:rs35826120)"
/id="VAR_051329"
MUTAGEN 531
/note="L->A: Abrogates nuclear redistribution."
/evidence="ECO:0000269|PubMed:15024033"
CONFLICT 36
/note="P -> S (in Ref. 7; BC025680)"
/evidence="ECO:0000305"
CONFLICT 539
/note="V -> L (in Ref. 1; BAA77507)"
/evidence="ECO:0000305"
CONFLICT 770
/note="P -> T (in Ref. 1; BAA77507)"
/evidence="ECO:0000305"
CONFLICT 788
/note="F -> L (in Ref. 4; CAB45702)"
/evidence="ECO:0000305"
CONFLICT 793..795
/note="GPA -> APP (in Ref. 1; BAA77507)"
/evidence="ECO:0000305"
CONFLICT 852
/note="L -> F (in Ref. 4; CAB45702)"
/evidence="ECO:0000305"
CONFLICT 865
/note="F -> Y (in Ref. 4; CAB45702)"
/evidence="ECO:0000305"
HELIX 484..502
/evidence="ECO:0000244|PDB:4GIW"
HELIX 508..515
/evidence="ECO:0000244|PDB:4GIW"
TURN 517..519
/evidence="ECO:0000244|PDB:4GIW"
HELIX 521..529
/evidence="ECO:0000244|PDB:4GIW"
HELIX 531..540
/evidence="ECO:0000244|PDB:4GIW"
STRAND 545..549
/evidence="ECO:0000244|PDB:4GIW"
TURN 550..552
/evidence="ECO:0000244|PDB:4GIW"
STRAND 553..556
/evidence="ECO:0000244|PDB:4GIW"
HELIX 559..566
/evidence="ECO:0000244|PDB:4GIW"
HELIX 574..585
/evidence="ECO:0000244|PDB:4GIW"
HELIX 592..606
/evidence="ECO:0000244|PDB:4GIW"
HELIX 609..617
/evidence="ECO:0000244|PDB:4GIW"
HELIX 620..626
/evidence="ECO:0000244|PDB:4GIW"
HELIX 632..635
/evidence="ECO:0000244|PDB:4GIW"
TURN 639..642
/evidence="ECO:0000244|PDB:4GIW"
HELIX 643..651
/evidence="ECO:0000244|PDB:4GIW"
HELIX 652..656
/evidence="ECO:0000244|PDB:4GIW"
SEQUENCE 902 AA; 96444 MW; 41DB65236E766A82 CRC64;
MLSPQRALLC NLNHIHLQHV SLGLHLSRRP ELQEGPLSTP PPPGDTGGKE SRGPCSGTLV
DANSNSPAVP CRCCQEHGPG LENRQDPSQE EEGAASPSDP GCSSSLSSCS DLSPDESPVS
VYLRDLPGDE DAHPQPSIIP LEQGSPLASA GPGTCSPDSF CCSPDSCSGA SSSPDPGLDS
NCNALTTCQD VPSPGLEEED ERAEQDLPTS ELLEADDGKI DAGKTEPSWK INPIWKIDTE
KTKAEWKTTE NNNTGWKNNG NVNSSWKSEP EKFDSGWKTN TRITDSGSKT DAGKIDGGWR
SDVSEEPVPH RTITSFHELA QKRKRGPGLP LVPQAKKDRS DWLIVFSPDT ELPPSGSPGG
SSAPPREVTT FKELRSRSRA PAPPVPPRDP PVGWALVPPR PPPPPVPPRR KKNRPGLQPI
AEGQSEEGRA VSPAAGEEAP AAKEPGAQAG LEVRSSWSFA GVPGAQRLWM AEAQSGTGQL
QEQKKGLLIA VSVSVDKIIS HFGAARNLVQ KAQLGDSRLS PDVGHLVLTT LCPALHALVA
DGLKPFRKDL ITGQRRSSPW SVVEASVKPG SSTRSLGTLY SQVSRLAPLS SSRSRFHAFI
LGLLNTKQLE LWFSSLQEDA GLLSLLYLPT GFFSLARGGC PSLSTELLLL LQPLSVLTFH
LDLLFEHHHH LPLGPPQAPA PPGPPPALQQ TMQAMLHFGG RLAQSLRGTS KEAASDPSDS
PNLPTPGSWW EQLTQASRVY ASGGTEGFPL SRWAPGRHGT AAEEGAQERP LPTDEMAPGR
GLWLGRLFGV PGGPAENENG ALKSRRPSSW LPPTVSVLAL VKRGAPPEMP SPQELEASAP
RMVQTHRAVR ALCDHTAARP DQLSFRRGEV LRVITTVDED WLRCGRDGME GLVPVGYTSL
VL


Related products :

Catalog number Product name Quantity
EIAAB36449 Homo sapiens,Human,Nesca,NESCA,New molecule containing SH3 at the carboxy-terminus,RUN and SH3 domain-containing protein 1,RUSC1
29-854 RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cell 0.1 mg
EIAAB41677 Mouse,Mus musculus,Ticam2,TICAM-2,TIR domain-containing adapter molecule 2,Tirp,Toll_interleukin-1 receptor domain-containing protein,Tram,TRIF-related adapter molecule
EIAAB38178 Mouse,Mus musculus,SH2 domain-containing protein 1A,Sh2d1a,Signaling lymphocytic activation molecule-associated protein,SLAM-associated protein,T-cell signal transduction molecule SAP,Xlp
EIAAB07175 Carboxy terminus of Hsp70-interacting protein,Chip,E3 ubiquitin-protein ligase CHIP,Mouse,Mus musculus,STIP1 homology and U box-containing protein 1,Stub1
EIAAB41676 Homo sapiens,Human,Proline-rich, vinculin and TIR domain-containing protein B,PRVTIRB,Putative NF-kappa-B-activating protein 502H,TICAM1,TICAM-1,TIR domain-containing adapter molecule 1,TIR domain-con
18-783-76491 GOAT ANTI HUMAN NESCA (C-TERMINAL) - LOCUS LINK ID 23623; RUN and SH3 domain containing 1. isoform CRA_a Polyclonal 0.1 mg
EIAAB07174 Antigen NY-CO-7,Carboxy terminus of Hsp70-interacting protein,CHIP,CLL-associated antigen KW-8,E3 ubiquitin-protein ligase CHIP,Homo sapiens,Human,PP1131,STIP1 homology and U box-containing protein 1,
EIAAB25899 MAJN,Molecule associated with JAK3 N-terminus,Mouse,Mus musculus,Myo18a,Myosin containing a PDZ domain,Myosin-XVIIIa,Myspdz
EIAAB41674 Mouse,Mus musculus,Ticam1,TICAM-1,TIR domain-containing adapter molecule 1,TIR domain-containing adapter protein inducing IFN-beta,Toll-interleukin-1 receptor domain-containing adapter protein inducin
EIAAB45786 Mouse,Mus musculus,Scam1,SCAM-1,SH3 domain-containing protein SH3P3,SH3-containing adapter molecule 1,Sh3d4,Sorbin and SH3 domain-containing protein 3,Sorbs3,Vinexin
EIAAB25898 Homo sapiens,Human,KIAA0216,MAJN,Molecule associated with JAK3 N-terminus,MYO18A,Myosin containing a PDZ domain,Myosin-XVIIIa,MYSPDZ
18-661-15184 TRIF-related adapter molecule - TICAM2 protein; TIRAP3a; TIRAP3a short form; TIR-containing adapter molecule-2; TIR domain-containing adapter protein; Putative NFkB activating protein Polyclonal 0.1 mg
18-661-15165 TRIF-related adapter molecule - TICAM2 protein; TIRAP3a; TIRAP3a short form; TIR-containing adapter molecule-2; TIR domain-containing adapter protein; Putative NFkB activating protein Polyclonal 0.1 mg
EIAAB41679 Homo sapiens,Human,Putative NF-kappa-B-activating protein 502,TICAM2,TICAM-2,TIR domain-containing adapter molecule 2,TIRAP3,TIRP,Toll_interleukin-1 receptor domain-containing protein,Toll-like recept
EIAAB41675 Bos taurus,Bovine,TICAM1,TICAM-1,TIR domain-containing adapter molecule 1,TIR domain-containing adapter protein inducing IFN-beta,Toll-interleukin-1 receptor domain-containing adapter protein inducing
CTDSP1-975H Protein: Recombinant Human CTD (Carboxy-Terminal Domain, RNA Polymerase II, Polypeptide A) Small, Phosphatase 1, His-tagged 50ug
CTDSP1-975H Protein Recombinant Human CTD (Carboxy-Terminal Domain, RNA Polymerase II, Polypeptide A) Small, Phosphatase 1, His-tagged 50ug
25-489 KLHL3 protein contains a poxvirus and zinc finger domain at the N-terminus and six tandem repeats (kelch repeats) at the C-terminus. At the amino acid level, KLHL3 shares 77 percent similarity with D 0.05 mg
29-037 KLHL3 protein contains a poxvirus and zinc finger domain at the N-terminus and six tandem repeats (kelch repeats) at the C-terminus. At the amino acid level, KLHL3 shares 77 percent similarity with D 0.1 mg
32-152 FES (feline sarcoma oncogene) and Fer are the only two members of a unique family of cytoplasmic protein tyrosine kinases. FES and Fer contain a central Src homology-2 (SH2) domain and a carboxy-termi 0.1 mL
32-153 FES (feline sarcoma oncogene) and Fer are the only two members of a unique family of cytoplasmic protein tyrosine kinases.FES and Fer contain a central Src homology-2 (SH2) domain and a carboxy-termin 0.1 mL
25-491 The exact function of the protein encoded by this gene is not known. However, POGK contains a KRAB domain (which is involved in protein-protein interactions) at the N-terminus, and a transposase domai 0.05 mg
EIAAB38179 DSHP,Duncan disease SH2-protein,Homo sapiens,Human,SAP,SH2 domain-containing protein 1A,SH2D1A,Signaling lymphocytic activation molecule-associated protein,SLAM-associated protein,T-cell signal transd
EIAAB09782 Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3,CTD small phosphatase-like protein,Ctdspl,CTDSP-like,Mouse,Mus musculus,Nif1,Nifl,NIF-like protein,NLI-interacting factor 1,
Pathways :
WP1689: Porphyrin and chlorophyll metabolism
WP2371: Parkinsons Disease Pathway
WP1049: G Protein Signaling Pathways
WP1713: Two-component system
WP1659: Glycine, serine and threonine metabolism
WP1665: Limonene and pinene degradation
WP525: Mitochondrial Unfolded-Protein Response
WP1438: Influenza A virus infection
WP1892: Protein folding
WP1531: Vitamin D synthesis
WP2032: TSH signaling pathway
WP1675: Nitrogen metabolism
WP813: G Protein Signaling Pathways
WP1685: Peptidoglycan biosynthesis
WP1616: ABC transporters
WP2199: Seed Development
WP1644: DNA replication
WP2272: Pathogenic Escherichia coli infection
WP1692: Protein export
WP1700: Selenoamino acid metabolism
WP1657: Glycerolipid metabolism
WP2324: AGE/RAGE pathway
WP1663: Homologous recombination
WP35: G Protein Signaling Pathways
WP1371: G Protein Signaling Pathways

Related Genes :
[RUSC1 NESCA] RUN and SH3 domain-containing protein 1 (New molecule containing SH3 at the carboxy-terminus) (Nesca)
[Sh3rf1 Posh Posh1 Sh3md2] E3 ubiquitin-protein ligase SH3RF1 (EC 2.3.2.27) (Plenty of SH3s) (Protein POSH) (RING-type E3 ubiquitin transferase SH3RF1) (SH3 domain-containing RING finger protein 1) (SH3 multiple domains protein 2)
[SH3PXD2A FISH KIAA0418 SH3MD1 TKS5] SH3 and PX domain-containing protein 2A (Adapter protein TKS5) (Five SH3 domain-containing protein) (SH3 multiple domains protein 1) (Tyrosine kinase substrate with five SH3 domains)
[Sh3pxd2a Fish Sh3md1 Tks5] SH3 and PX domain-containing protein 2A (Five SH3 domain-containing protein) (SH3 multiple domains protein 1) (Tyrosine kinase substrate with five SH3 domains)
[NCKIPSD AF3P21 SPIN90] NCK-interacting protein with SH3 domain (54 kDa VacA-interacting protein) (54 kDa vimentin-interacting protein) (VIP54) (90 kDa SH3 protein interacting with Nck) (AF3p21) (Dia-interacting protein 1) (DIP-1) (Diaphanous protein-interacting protein) (SH3 adapter protein SPIN90) (WASP-interacting SH3-domain protein) (WISH) (Wiskott-Aldrich syndrome protein-interacting protein)
[Abi1 Ssh3bp1] Abl interactor 1 (Abelson interactor 1) (Abi-1) (Ablphilin-1) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (Spectrin SH3 domain-binding protein 1) (e3B1)
[ITSN2 KIAA1256 SH3D1B SWAP] Intersectin-2 (SH3 domain-containing protein 1B) (SH3P18) (SH3P18-like WASP-associated protein)
[ABI1 SSH3BP1] Abl interactor 1 (Abelson interactor 1) (Abi-1) (Abl-binding protein 4) (AblBP4) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (Nap1-binding protein) (Nap1BP) (Spectrin SH3 domain-binding protein 1) (e3B1)
[Sh3gl2 Sh3d2a Sh3p4] Endophilin-A1 (Endophilin-1) (SH3 domain protein 2A) (SH3 domain-containing GRB2-like protein 2) (SH3p4)
[SH3RF1 KIAA1494 POSH POSH1 RNF142 SH3MD2] E3 ubiquitin-protein ligase SH3RF1 (EC 2.3.2.27) (Plenty of SH3s) (Protein POSH) (RING finger protein 142) (RING-type E3 ubiquitin transferase SH3RF1) (SH3 domain-containing RING finger protein 1) (SH3 multiple domains protein 2)
[Sh3rf1 Kiaa1494 Posh Posh1 Sh3md2] E3 ubiquitin-protein ligase SH3RF1 (EC 2.3.2.27) (Plenty of SH3s) (Protein POSH) (RING-type E3 ubiquitin transferase SH3RF1) (SH3 domain-containing RING finger protein 1) (SH3 multiple domains protein 2)
[SH3GL2 CNSA2 SH3D2A] Endophilin-A1 (EEN-B1) (Endophilin-1) (SH3 domain protein 2A) (SH3 domain-containing GRB2-like protein 2)
[SH3KBP1 CIN85] SH3 domain-containing kinase-binding protein 1 (CD2-binding protein 3) (CD2BP3) (Cbl-interacting protein of 85 kDa) (Human Src family kinase-binding protein 1) (HSB-1)
[SH3RF2 POSH3 POSHER PPP1R39 RNF158] E3 ubiquitin-protein ligase SH3RF2 (EC 2.3.2.27) (Heart protein phosphatase 1-binding protein) (HEPP1) (POSH-eliminating RING protein) (Protein phosphatase 1 regulatory subunit 39) (RING finger protein 158) (RING-type E3 ubiquitin transferase SH3RF2) (SH3 domain-containing RING finger protein 2)
[Sh3kbp1 Ruk Seta] SH3 domain-containing kinase-binding protein 1 (Regulator of ubiquitous kinase) (Ruk) (SH3-containing, expressed in tumorigenic astrocytes)
[Sh3kbp1 Ruk Seta] SH3 domain-containing kinase-binding protein 1 (Regulator of ubiquitous kinase) (Ruk) (SH3-containing, expressed in tumorigenic astrocytes)
[SASH1 KIAA0790 PEPE1] SAM and SH3 domain-containing protein 1 (Proline-glutamate repeat-containing protein)
[Sh3bp1 3bp1] SH3 domain-binding protein 1 (3BP-1)
[SH3BP1] SH3 domain-binding protein 1
[NCF4 SH3PXD4] Neutrophil cytosol factor 4 (NCF-4) (Neutrophil NADPH oxidase factor 4) (SH3 and PX domain-containing protein 4) (p40-phox) (p40phox)
[SH3BP5 SAB] SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK)
[Dbnl Abp1 Sh3p7] Drebrin-like protein (Actin-binding protein 1) (SH3 domain-containing protein 7)
[GRB2 ASH] Growth factor receptor-bound protein 2 (Adapter protein GRB2) (Protein Ash) (SH2/SH3 adapter GRB2)
[G3bp1 G3bp] Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (GAP SH3 domain-binding protein 1) (HDH-VIII)
[SH3PXD2B FAD49 KIAA1295 TKS4] SH3 and PX domain-containing protein 2B (Adapter protein HOFI) (Factor for adipocyte differentiation 49) (Tyrosine kinase substrate with four SH3 domains)
[FCHSD2 KIAA0769 SH3MD3] F-BAR and double SH3 domains protein 2 (Carom) (Protein nervous wreck 1) (NWK1) (SH3 multiple domains protein 3)
[SH3GLB1 KIAA0491 CGI-61] Endophilin-B1 (Bax-interacting factor 1) (Bif-1) (SH3 domain-containing GRB2-like protein B1)
[Sh3rf2 Posh3 Posher Ppp1r39 Rnf158] E3 ubiquitin-protein ligase SH3RF2 (EC 2.3.2.27) (POSH-eliminating RING protein) (Protein phosphatase 1 regulatory subunit 39) (RING finger protein 158) (RING-type E3 ubiquitin transferase SH3RF2) (SH3 domain-containing RING finger protein 2)
[SH3D19] SH3 domain-containing protein 19 (ADAM-binding protein Eve-1) (EEN-binding protein) (EBP)
[SH3RF3 POSH2 SH3MD4] E3 ubiquitin-protein ligase SH3RF3 (EC 2.3.2.27) (Plenty of SH3s 2) (SH3 domain-containing RING finger protein 3) (SH3 multiple domains protein 4)

Bibliography :
No related Items