GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Retinoic acid early transcript 1E (Lymphocyte effector toxicity activation ligand) (NKG2D ligand 4) (N2DL-4) (NKG2DL4) (RAE-1-like transcript 4) (UL16-binding protein 4)

 RAE1E_HUMAN             Reviewed;         263 AA.
Q8TD07; A6YF59; Q5VYB7; Q5VYB8; Q8TEZ2; Q96L41;
24-MAY-2004, integrated into UniProtKB/Swiss-Prot.
01-JUN-2002, sequence version 1.
13-FEB-2019, entry version 145.
RecName: Full=Retinoic acid early transcript 1E {ECO:0000303|PubMed:11827464, ECO:0000312|HGNC:HGNC:16793};
AltName: Full=Lymphocyte effector toxicity activation ligand {ECO:0000303|PubMed:14508119};
AltName: Full=NKG2D ligand 4;
Short=N2DL-4;
Short=NKG2DL4;
AltName: Full=RAE-1-like transcript 4 {ECO:0000303|Ref.5};
AltName: Full=UL16-binding protein 4;
Flags: Precursor;
Name=RAET1E {ECO:0000303|PubMed:11827464,
ECO:0000312|HGNC:HGNC:16793};
Synonyms=LETAL {ECO:0000303|PubMed:14508119}, N2DL4,
ULBP4 {ECO:0000303|PubMed:12732206};
ORFNames=UNQ1867/PRO4303 {ECO:0000303|PubMed:12975309};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND TISSUE SPECIFICITY.
TISSUE=Ovarian carcinoma;
PubMed=14508119; DOI=10.4161/cbt.2.4.479;
Conejo-Garcia J.-R., Benencia F., Courreges M.C., Khang E., Zhang L.,
Mohamed-Hadley A., Vinocur J.M., Buckanovich R.J., Thompson C.B.,
Levine B., Coukos G.;
"Letal, a tumor-associated NKG2D immunoreceptor ligand, induces
activation and expansion of effector immune cells.";
Cancer Biol. Ther. 2:446-451(2003).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND TISSUE SPECIFICITY.
TISSUE=Esophagus;
PubMed=12732206; DOI=10.1016/S0006-291X(03)00714-9;
Chalupny N.J., Sutherland C.L., Lawrence W.A., Rein-Weston A.,
Cosman D.;
"ULBP4 is a novel ligand for human NKG2D.";
Biochem. Biophys. Res. Commun. 305:129-135(2003).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH KLRK1, LACK
OF INTERACTION WITH CMV UL16, AND SUBCELLULAR LOCATION.
PubMed=15240696; DOI=10.4049/jimmunol.173.2.1078;
Bacon L., Eagle R.A., Meyer M., Easom N., Young N.T., Trowsdale J.;
"Two human ULBP/RAET1 molecules with transmembrane regions are ligands
for NKG2D.";
J. Immunol. 173:1078-1084(2004).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), AND ALTERNATIVE SPLICING.
PubMed=17470428; DOI=10.1074/jbc.M702504200;
Cao W., Xi X., Hao Z., Li W., Kong Y., Cui L., Ma C., Ba D., He W.;
"RAET1E2, a soluble isoform of the UL16-binding protein RAET1E
produced by tumor cells, inhibits NKG2D-mediated NK cytotoxicity.";
J. Biol. Chem. 282:18922-18928(2007).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Lanier L.L., Cerwenka A.;
"Homo sapiens RAE-1-like transcript 4 (RL-4) mRNA.";
Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), AND VARIANT
ASN-82.
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=14574404; DOI=10.1038/nature02055;
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L.,
Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E.,
Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R.,
Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S.,
Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J.,
Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P.,
Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y.,
Burford D.C., Burrill W., Burton J., Carder C., Carter N.P.,
Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V.,
Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J.,
Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E.,
Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A.,
Frankland J., French L., Garner P., Garnett J., Ghori M.J.,
Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M.,
Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S.,
Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R.,
Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E.,
Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A.,
Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C.,
Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M.,
Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M.,
Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K.,
McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T.,
Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R.,
Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W.,
Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M.,
Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L.,
Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J.,
Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B.,
Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L.,
Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W.,
Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A.,
Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.;
"The DNA sequence and analysis of human chromosome 6.";
Nature 425:805-811(2003).
[8]
NUCLEOTIDE SEQUENCE [MRNA] OF 1-222 (ISOFORM 1), AND VARIANTS ASN-82
AND HIS-128.
PubMed=11827464; DOI=10.1006/geno.2001.6673;
Radosavljevic M., Cuillerier B., Wilson M.J., Clement O., Wicker S.,
Gilfillan S., Beck S., Trowsdale J., Bahram S.;
"A cluster of ten novel MHC class I related genes on human chromosome
6q24.2-q25.3.";
Genomics 79:114-123(2002).
[9]
ALTERNATIVE SPLICING (ISOFORMS 2; 5 AND 6), INTERACTION WITH KLRK1,
FUNCTION, REGION, AND DOMAIN.
PubMed=18544572; DOI=10.1093/intimm/dxn057;
Cao W., Xi X., Wang Z., Dong L., Hao Z., Cui L., Ma C., He W.;
"Four novel ULBP splice variants are ligands for human NKG2D.";
Int. Immunol. 20:981-991(2008).
-!- FUNCTION: Binds and activates the KLRK1/NKG2D receptor, mediating
natural killer cell cytotoxicity. {ECO:0000269|PubMed:15240696,
ECO:0000269|PubMed:18544572}.
-!- SUBUNIT: Binds to KLRK1/NKG2D. {ECO:0000269|PubMed:15240696,
ECO:0000269|PubMed:18544572}.
-!- SUBUNIT: (Microbial infection) Contrary to other family members,
does not interact with CMV glycoprotein UL16.
{ECO:0000269|PubMed:15240696}.
-!- INTERACTION:
P26718:KLRK1; NbExp=4; IntAct=EBI-16365677, EBI-458344;
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000269|PubMed:15240696};
Single-pass type I membrane protein.
-!- SUBCELLULAR LOCATION: Isoform 4: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=1; Synonyms=ULBP4 {ECO:0000303|PubMed:12732206}, RAET1E
{ECO:0000303|PubMed:15240696};
IsoId=Q8TD07-1; Sequence=Displayed;
Name=2; Synonyms=RL-4 {ECO:0000303|Ref.5}, ULBP4-II
{ECO:0000303|PubMed:18544572};
IsoId=Q8TD07-2; Sequence=VSP_010441;
Name=3;
IsoId=Q8TD07-3; Sequence=VSP_010442, VSP_010443;
Note=No experimental confirmation available.;
Name=4; Synonyms=RAET1E2 {ECO:0000303|PubMed:17470428};
IsoId=Q8TD07-4; Sequence=VSP_045012;
Name=5; Synonyms=ULBP4-III {ECO:0000303|PubMed:18544572};
IsoId=Q8TD07-5; Sequence=VSP_059263;
Name=6; Synonyms=ULBP4-I {ECO:0000303|PubMed:18544572};
IsoId=Q8TD07-6; Sequence=VSP_059262;
-!- TISSUE SPECIFICITY: Predominantly expressed in the skin, but also
expressed in testis and trachea. Up-regulated in tumor cells of
different origins. Expression progressively decreased after
treatment of tumor cells with retinoic acid.
{ECO:0000269|PubMed:12732206, ECO:0000269|PubMed:14508119}.
-!- DOMAIN: MHC class I alpha-1 like and MHC class I alpha- like
regions down-regulate the cell surface expression of KLRK1.
{ECO:0000269|PubMed:18544572}.
-!- MISCELLANEOUS: UL16-binding proteins (ULBPs) are unusual members
of the extended MHC class I superfamily. They do not contain the
alpha 3 domain and lack a transmembrane domain. {ECO:0000305}.
-!- SIMILARITY: Belongs to the MHC class I family. {ECO:0000305}.
-!- CAUTION: Contrary to other family members, does not interact with
CMV glycoprotein UL16. {ECO:0000269|PubMed:15240696}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AY069961; AAL58090.1; -; mRNA.
EMBL; AY252119; AAP15166.1; -; mRNA.
EMBL; AY176317; AAO22240.1; -; mRNA.
EMBL; EF489426; ABR29881.1; -; mRNA.
EMBL; AY054974; AAL11005.1; -; mRNA.
EMBL; AY359075; AAQ89434.1; -; mRNA.
EMBL; AL355312; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AF359243; AAL76417.1; -; mRNA.
CCDS; CCDS5221.1; -. [Q8TD07-1]
CCDS; CCDS59042.1; -. [Q8TD07-4]
CCDS; CCDS59043.1; -. [Q8TD07-3]
CCDS; CCDS59044.1; -. [Q8TD07-2]
RefSeq; NP_001230254.1; NM_001243325.1. [Q8TD07-2]
RefSeq; NP_001230256.1; NM_001243327.1. [Q8TD07-4]
RefSeq; NP_001230257.1; NM_001243328.1. [Q8TD07-3]
RefSeq; NP_631904.1; NM_139165.2. [Q8TD07-1]
RefSeq; XP_011533781.1; XM_011535479.2. [Q8TD07-3]
UniGene; Hs.511818; -.
ProteinModelPortal; Q8TD07; -.
BioGrid; 126425; 19.
IntAct; Q8TD07; 1.
STRING; 9606.ENSP00000349709; -.
PhosphoSitePlus; Q8TD07; -.
BioMuta; RAET1E; -.
jPOST; Q8TD07; -.
PaxDb; Q8TD07; -.
PeptideAtlas; Q8TD07; -.
PRIDE; Q8TD07; -.
ProteomicsDB; 74206; -.
ProteomicsDB; 74207; -. [Q8TD07-2]
ProteomicsDB; 74208; -. [Q8TD07-3]
Ensembl; ENST00000357183; ENSP00000349709; ENSG00000164520. [Q8TD07-1]
Ensembl; ENST00000367363; ENSP00000356332; ENSG00000164520. [Q8TD07-2]
Ensembl; ENST00000529948; ENSP00000432366; ENSG00000164520. [Q8TD07-4]
Ensembl; ENST00000532335; ENSP00000437067; ENSG00000164520. [Q8TD07-3]
GeneID; 135250; -.
KEGG; hsa:135250; -.
UCSC; uc003qnj.3; human. [Q8TD07-1]
CTD; 135250; -.
DisGeNET; 135250; -.
EuPathDB; HostDB:ENSG00000164520.11; -.
GeneCards; RAET1E; -.
H-InvDB; HIX0032797; -.
HGNC; HGNC:16793; RAET1E.
HPA; HPA054022; -.
MIM; 609243; gene.
neXtProt; NX_Q8TD07; -.
OpenTargets; ENSG00000164520; -.
PharmGKB; PA134913788; -.
eggNOG; ENOG410JBPA; Eukaryota.
eggNOG; ENOG411150N; LUCA.
GeneTree; ENSGT00390000003472; -.
HOGENOM; HOG000070028; -.
HOVERGEN; HBG052564; -.
InParanoid; Q8TD07; -.
KO; K07987; -.
OMA; ASDIHWS; -.
OrthoDB; 1092787at2759; -.
PhylomeDB; Q8TD07; -.
TreeFam; TF339658; -.
Reactome; R-HSA-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
GeneWiki; RAET1E; -.
GenomeRNAi; 135250; -.
PRO; PR:Q8TD07; -.
Proteomes; UP000005640; Chromosome 6.
Bgee; ENSG00000164520; Expressed in 90 organ(s), highest expression level in ectocervix.
ExpressionAtlas; Q8TD07; baseline and differential.
Genevisible; Q8TD07; HS.
GO; GO:0009897; C:external side of plasma membrane; IBA:GO_Central.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; IBA:GO_Central.
GO; GO:0046703; F:natural killer cell lectin-like receptor binding; IPI:UniProtKB.
GO; GO:0006955; P:immune response; IBA:GO_Central.
GO; GO:0030101; P:natural killer cell activation; IBA:GO_Central.
GO; GO:0042267; P:natural killer cell mediated cytotoxicity; IDA:UniProtKB.
GO; GO:0045954; P:positive regulation of natural killer cell mediated cytotoxicity; IDA:UniProtKB.
GO; GO:0050776; P:regulation of immune response; TAS:Reactome.
GO; GO:0042271; P:susceptibility to natural killer cell mediated cytotoxicity; IBA:GO_Central.
GO; GO:0001913; P:T cell mediated cytotoxicity; IBA:GO_Central.
Gene3D; 3.30.500.10; -; 1.
InterPro; IPR011161; MHC_I-like_Ag-recog.
InterPro; IPR037055; MHC_I-like_Ag-recog_sf.
InterPro; IPR011162; MHC_I/II-like_Ag-recog.
Pfam; PF00129; MHC_I; 1.
SUPFAM; SSF54452; SSF54452; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Disulfide bond; Glycoprotein;
Immunity; Membrane; Polymorphism; Reference proteome; Secreted;
Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 30 {ECO:0000255}.
CHAIN 31 263 Retinoic acid early transcript 1E.
/FTId=PRO_0000019021.
TOPO_DOM 31 225 Extracellular. {ECO:0000255}.
TRANSMEM 226 248 Helical. {ECO:0000255}.
TOPO_DOM 249 263 Cytoplasmic. {ECO:0000255}.
REGION 31 116 MHC class I alpha-1 like; down-regulates
the cell surface expression of KLRK1.
{ECO:0000269|PubMed:18544572}.
REGION 117 207 MHC class I alpha-2 like; down-regulates
the cell surface expression of KLRK1.
{ECO:0000269|PubMed:18544572}.
COMPBIAS 219 222 Poly-Ser.
CARBOHYD 36 36 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 154 154 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 212 212 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 126 189 {ECO:0000250}.
VAR_SEQ 28 63 Missing (in isoform 2).
{ECO:0000303|Ref.5}.
/FTId=VSP_010441.
VAR_SEQ 29 29 G -> GECPEHKNWLRTRRREKG (in isoform 6).
{ECO:0000303|PubMed:18544572}.
/FTId=VSP_059262.
VAR_SEQ 165 208 SKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPE
PTV -> M (in isoform 5).
{ECO:0000303|PubMed:18544572}.
/FTId=VSP_059263.
VAR_SEQ 208 263 VSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWW
QNGEWQAGLWPLRTS -> GN (in isoform 4).
{ECO:0000303|PubMed:17470428}.
/FTId=VSP_045012.
VAR_SEQ 208 212 VSPVN -> GRRST (in isoform 3).
{ECO:0000303|PubMed:12975309}.
/FTId=VSP_010442.
VAR_SEQ 213 263 Missing (in isoform 3).
{ECO:0000303|PubMed:12975309}.
/FTId=VSP_010443.
VARIANT 12 12 R -> H (in dbSNP:rs9383583).
/FTId=VAR_024534.
VARIANT 82 82 Y -> N (in dbSNP:rs2151910).
{ECO:0000269|PubMed:11827464,
ECO:0000269|PubMed:12975309}.
/FTId=VAR_020271.
VARIANT 128 128 R -> H (in dbSNP:rs6925151).
{ECO:0000269|PubMed:11827464}.
/FTId=VAR_024535.
VARIANT 141 141 A -> T (in dbSNP:rs9383921).
/FTId=VAR_050408.
VARIANT 142 142 T -> I (in dbSNP:rs9371533).
/FTId=VAR_050409.
VARIANT 194 194 R -> G (in dbSNP:rs57292884).
/FTId=VAR_061483.
VARIANT 237 237 V -> L (in dbSNP:rs2342767).
/FTId=VAR_024536.
CONFLICT 141 142 AT -> TI (in Ref. 8; AAL76417).
{ECO:0000305}.
SEQUENCE 263 AA; 30122 MW; 3309279B51B603C8 CRC64;
MRRISLTSSP VRLLLFLLLL LIALEIMVGG HSLCFNFTIK SLSRPGQPWC EAQVFLNKNL
FLQYNSDNNM VKPLGLLGKK VYATSTWGEL TQTLGEVGRD LRMLLCDIKP QIKTSDPSTL
QVEMFCQREA ERCTGASWQF ATNGEKSLLF DAMNMTWTVI NHEASKIKET WKKDRGLEKY
FRKLSKGDCD HWLREFLGHW EAMPEPTVSP VNASDIHWSS SSLPDRWIIL GAFILLVLMG
IVLICVWWQN GEWQAGLWPL RTS


Related products :

Catalog number Product name Quantity
EIAAB26177 Homo sapiens,Human,LETAL,Lymphocyte effector toxicity activation ligand,N2DL4,N2DL-4,NKG2D ligand 4,NKG2DL4,RAE-1-like transcript 4,RAET1E,Retinoic acid early transcript 1E,RL-4,ULBP4,UNQ1867_PRO4303
EIAAB26175 ALCAN-beta,Homo sapiens,Human,N2DL1,N2DL-1,NKG2D ligand 1,NKG2DL1,RAET1I,Retinoic acid early transcript 1I,UL16-binding protein 1,ULBP1
E2254h ALCAN-alpha,Homo sapiens,Human,N2DL2,N2DL-2,NKG2D ligand 2,NKG2DL2,RAET1H,Retinoic acid early transcript 1H,UL16-binding protein 2,ULBP2,UNQ463_PRO791
E2254h ELISA kit ALCAN-alpha,Homo sapiens,Human,N2DL2,N2DL-2,NKG2D ligand 2,NKG2DL2,RAET1H,Retinoic acid early transcript 1H,UL16-binding protein 2,ULBP2,UNQ463_PRO791 96T
U2254h CLIA kit ALCAN-alpha,Homo sapiens,Human,N2DL2,N2DL-2,NKG2D ligand 2,NKG2DL2,RAET1H,Retinoic acid early transcript 1H,UL16-binding protein 2,ULBP2,UNQ463_PRO791 96T
U2254h CLIA ALCAN-alpha,Homo sapiens,Human,N2DL2,N2DL-2,NKG2D ligand 2,NKG2DL2,RAET1H,Retinoic acid early transcript 1H,UL16-binding protein 2,ULBP2,UNQ463_PRO791 96T
E2254h ELISA ALCAN-alpha,Homo sapiens,Human,N2DL2,N2DL-2,NKG2D ligand 2,NKG2DL2,RAET1H,Retinoic acid early transcript 1H,UL16-binding protein 2,ULBP2,UNQ463_PRO791 96T
EIAAB26176 ALCAN-gamma,Homo sapiens,Human,N2DL3,N2DL-3,NKG2D ligand 3,NKG2DL3,RAET1N,Retinoic acid early transcript 1N,ULBP3
G7391 Retinoic acid early transcript 1L protein (RAET1L), Human, ELISA Kit 96T
CSB-EL019282HU Human Retinoic acid early transcript 1L protein(RAET1L) ELISA kit 96T
G7390 Retinoic acid early transcript 1G protein (RAET1G), Human, ELISA Kit 96T
CSB-EL019279HU Human Retinoic acid early transcript 1G protein(RAET1G) ELISA kit 96T
EIAAB34307 Homo sapiens,Human,RAET1L,Retinoic acid early transcript 1L protein
EIAAB34306 Homo sapiens,Human,RAET1G,Retinoic acid early transcript 1G protein
CSB-EL019279HU Human Retinoic acid early transcript 1G protein(RAET1G) ELISA kit SpeciesHuman 96T
CSB-EL019282HU Human Retinoic acid early transcript 1L protein(RAET1L) ELISA kit SpeciesHuman 96T
RPR-293 Recombinant Human Retinoic Acid Early Transcript 1E 5
E02R0352 Rat Retinoic Acid Early Transcript 1G ELISA 96T/kit
E02R0358 Rat Retinoic Acid Early Transcript 1L ELISA 96T/kit
pro-1293 Recombinant Human Retinoic Acid Early Transcript 1E 1mg
E14R0352 Sheep Retinoic Acid Early Transcript 1G ELISA 96T/kit
E12R0352 Chicken Retinoic Acid Early Transcript 1G ELISA 96T/kit
pro-1608 Recombinant Human Retinoic Acid Early Transcript 1G 2
E08R0352 Canine Retinoic Acid Early Transcript 1G ELISA 96T/kit
pro-1293 Recombinant Human Retinoic Acid Early Transcript 1E 5

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1825: GPCR ligand binding
WP1089: Small Ligand GPCRs
WP1317: Small Ligand GPCRs
WP1498: Dopminergic Neurogenesis
WP1531: Vitamin D synthesis
WP161: Small Ligand GPCRs
WP1616: ABC transporters
WP1654: gamma-Hexachlorocyclohexane degradation
WP1700: Selenoamino acid metabolism
WP2292: Chemokine signaling pathway
WP2355: Corticotropin-releasing hormone
WP247: Small Ligand GPCRs
WP353: Small Ligand GPCRs
WP731: Sterol regulatory element binding protein related
WP746: Small Ligand GPCRs
WP853: Small Ligand GPCRs
WP971: Small Ligand GPCRs
WP1008: amino acid conjugation of benzoic acid
WP1020: Fatty Acid Biosynthesis
WP1049: G Protein Signaling Pathways
WP105: Fatty Acid Beta Oxidation 2
WP1061: Fatty Acid Beta Oxidation
WP1075: Folic Acid Network
WP1095: Complement Activation, Classical Pathway
WP1099: Nuclear receptors in lipid metabolism and toxicity

Related Genes :
[Klrk1 Nkg2d Nkrp2] NKG2-D type II integral membrane protein (Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NK lectin-like receptor) (NKLLR) (NKG2-D-activating NK receptor) (NKR-P2) (CD antigen CD314)
[todS dhkD T1E_4275/T1E_4276] Sensor histidine kinase TodS (EC 2.7.13.3)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[nef] Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[todT tobT T1E_4277] Response regulator protein TodT
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[nef] Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[tat] Protein Tat (Transactivating regulatory protein)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[nef] Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein]
[DRP1E ADL1E ADL4 DLP2 At3g60190 T2O9.170] Dynamin-related protein 1E (Dynamin-like protein 4) (Dynamin-like protein DLP2) (Dynamin-like protein E)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[MICA PERB11.1] MHC class I polypeptide-related sequence A (MIC-A)
[HCST DAP10 KAP10 PIK3AP UNQ587/PRO1157] Hematopoietic cell signal transducer (DNAX-activation protein 10) (Membrane protein DAP10) (Transmembrane adapter protein KAP10)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[tat] Protein Tat (Transactivating regulatory protein)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[rplP b3313 JW3275] 50S ribosomal protein L16 (Large ribosomal subunit protein uL16)
[] Genome polyprotein [Cleaved into: Core protein p21 (Capsid protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (p23) (EC 3.4.22.-); Serine protease NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3P) (p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)]
[] Genome polyprotein [Cleaved into: P3; Protein 3AB; P2; P1; Capsid protein VP0 (VP4-VP2); Capsid protein VP4 (P1A) (Virion protein 4); Capsid protein VP2 (P1B) (Virion protein 2); Capsid protein VP3 (P1C) (Virion protein 3); Capsid protein VP1 (P1D) (Virion protein 1); Protease 2A (P2A) (EC 3.4.22.29) (Picornain 2A) (Protein 2A); Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3A (P3A); Viral protein genome-linked (VPg) (Protein 3B) (P3B); Protein 3CD (EC 3.4.22.28); Protease 3C (P3C); RNA-directed RNA polymerase (RdRp) (EC 2.7.7.48) (3D polymerase) (3Dpol) (Protein 3D) (3D)]
[tat] Protein Tat (Transactivating regulatory protein)

Bibliography :
?>