GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

SH2 domain-containing adapter protein B

 SHB_MOUSE               Reviewed;         503 AA.
Q6PD21; A2AKW3; Q3ULM3;
25-JUL-2006, integrated into UniProtKB/Swiss-Prot.
25-JUL-2006, sequence version 2.
17-JUN-2020, entry version 118.
RecName: Full=SH2 domain-containing adapter protein B;
Name=Shb;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
STRAIN=C57BL/6J; TISSUE=Embryo;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.,
Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R.,
Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T.,
Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A.,
Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B.,
Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M.,
Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S.,
Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D.,
Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M.,
Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H.,
Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V.,
Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S.,
Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H.,
Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N.,
Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F.,
Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G.,
Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z.,
Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S.,
Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K.,
Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R.,
van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H.,
Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M.,
Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C.,
Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S.,
Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K.,
Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M.,
Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C.,
Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A.,
Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=C57BL/6J;
PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X.,
Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y.,
Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S.,
Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R.,
Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K.,
Eichler E.E., Ponting C.P.;
"Lineage-specific biology revealed by a finished genome assembly of the
mouse.";
PLoS Biol. 7:E1000112-E1000112(2009).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=C57BL/6J; TISSUE=Fetal brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
TISSUE SPECIFICITY.
PubMed=8302579;
Welsh M., Mares J., Karlsson T., Lavergne C., Breant B., Claesson-Welsh L.;
"Shb is a ubiquitously expressed Src homology 2 protein.";
Oncogene 9:19-27(1994).
[5]
INDUCTION BY OKADAIC ACID AND GENISTEIN.
PubMed=8777141; DOI=10.1016/0898-6568(95)02019-5;
Lavergne C., Mares J., Karlsson T., Breant B., Welsh M.;
"Control of SHB gene expression by protein phosphorylation.";
Cell. Signal. 8:55-58(1996).
[6]
INTERACTION WITH PTPN11.
PubMed=12181353; DOI=10.1091/mbc.e02-02-0103;
Cross M.J., Lu L., Magnusson P., Nyqvist D., Holmqvist K., Welsh M.,
Claesson-Welsh L.;
"The Shb adaptor protein binds to tyrosine 766 in the FGFR-1 and regulates
the Ras/MEK/MAPK pathway via FRS2 phosphorylation in endothelial cells.";
Mol. Biol. Cell 13:2881-2893(2002).
[7]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=17242355; DOI=10.1073/pnas.0609836104;
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
"Large-scale phosphorylation analysis of mouse liver.";
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-382, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19144319; DOI=10.1016/j.immuni.2008.11.006;
Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,
Thibault P.;
"The phagosomal proteome in interferon-gamma-activated macrophages.";
Immunity 30:143-154(2009).
[9]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-382, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Brain, Heart, Kidney, Lung, and Pancreas;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: Adapter protein which regulates several signal transduction
cascades by linking activated receptors to downstream signaling
components. May play a role in angiogenesis by regulating FGFR1, VEGFR2
and PDGFR signaling. May also play a role in T-cell antigen
receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal
cells differentiation by mediating basic-FGF and NGF-induced signaling
cascades. May also regulate IRS1 and IRS2 signaling in insulin-
producing cells (By similarity). {ECO:0000250}.
-!- SUBUNIT: Interacts with phosphorylated 'Tyr-720' of the ligand-
activated receptor PDGFRA via its SH2 domain. Interacts with the
ligand-activated receptors PDGFRB, FGFR1, KDR/VEGFR2, IL2RB and IL2RG.
Interacts with EPS8 and V-SRC. Interacts with GRB2 and GRAP. Interacts
with CD3Z. Interacts with tyrosine-phosphorylated LAT upon T-cell
antigen receptor activation. Interacts with PLCG1. Interacts with
ZAP70, LCP2/SLP-76, VAV1 and GRAP2. Interacts with JAK1 and JAK3.
Interacts with PTK2/FAK1. Interacts with CRK/CrKII. Interacts with IRS2
(By similarity). Interacts with PTPN11. {ECO:0000250,
ECO:0000269|PubMed:12181353}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Cell membrane
{ECO:0000250}; Peripheral membrane protein {ECO:0000250}; Cytoplasmic
side {ECO:0000250}. Note=Associates with membrane lipid rafts upon TCR
stimulation. {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q6PD21-1; Sequence=Displayed;
Name=2;
IsoId=Q6PD21-2; Sequence=VSP_019848, VSP_019849, VSP_019850;
-!- TISSUE SPECIFICITY: Expressed in heart, liver, brain and kidney (at
protein level). {ECO:0000269|PubMed:8302579}.
-!- INDUCTION: Up-regulated by okadaic acid and genistein.
{ECO:0000269|PubMed:8777141}.
-!- DOMAIN: The SH2 domain preferentially binds phosphopeptides with the
consensus sequence Y-[TVI]-X-L and mediates interaction with PDGFRA,
PDGFRB, FGRFR1, IL2RB, IL2RG, CD3Z and CRK/CrKII. {ECO:0000250}.
-!- PTM: Phosphorylated upon PDGFRA, PDGFRB, TCR, IL2 receptor, FGFR1 or
VEGFR2 activation. {ECO:0000250}.
-!- SEQUENCE CAUTION:
Sequence=AAH58986.1; Type=Erroneous initiation; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AK145414; BAE26425.1; -; mRNA.
EMBL; AL772376; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC058986; AAH58986.1; ALT_INIT; mRNA.
CCDS; CCDS51173.1; -. [Q6PD21-1]
RefSeq; NP_001028478.1; NM_001033306.1. [Q6PD21-1]
BioGRID; 230937; 2.
IntAct; Q6PD21; 2.
MINT; Q6PD21; -.
STRING; 10090.ENSMUSP00000060433; -.
iPTMnet; Q6PD21; -.
PhosphoSitePlus; Q6PD21; -.
PaxDb; Q6PD21; -.
PRIDE; Q6PD21; -.
Ensembl; ENSMUST00000061986; ENSMUSP00000060433; ENSMUSG00000044813. [Q6PD21-1]
GeneID; 230126; -.
KEGG; mmu:230126; -.
UCSC; uc008sst.2; mouse. [Q6PD21-1]
UCSC; uc008ssu.1; mouse. [Q6PD21-2]
CTD; 6461; -.
MGI; MGI:98294; Shb.
eggNOG; ENOG410IGWI; Eukaryota.
eggNOG; ENOG410XQJ2; LUCA.
GeneTree; ENSGT00940000161591; -.
HOGENOM; CLU_029444_0_0_1; -.
InParanoid; Q6PD21; -.
KO; K23697; -.
OMA; PAAASCF; -.
OrthoDB; 1120795at2759; -.
PhylomeDB; Q6PD21; -.
TreeFam; TF325799; -.
Reactome; R-MMU-4420097; VEGFA-VEGFR2 Pathway.
BioGRID-ORCS; 230126; 3 hits in 14 CRISPR screens.
ChiTaRS; Shb; mouse.
PRO; PR:Q6PD21; -.
Proteomes; UP000000589; Chromosome 4.
RNAct; Q6PD21; protein.
Bgee; ENSMUSG00000044813; Expressed in decidua and 210 other tissues.
ExpressionAtlas; Q6PD21; baseline and differential.
Genevisible; Q6PD21; MM.
GO; GO:0036464; C:cytoplasmic ribonucleoprotein granule; ISO:MGI.
GO; GO:0005829; C:cytosol; ISO:MGI.
GO; GO:0005654; C:nucleoplasm; ISO:MGI.
GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0001784; F:phosphotyrosine residue binding; ISO:MGI.
GO; GO:0005070; F:SH3/SH2 adaptor activity; TAS:MGI.
GO; GO:0001525; P:angiogenesis; IEA:UniProtKB-KW.
GO; GO:0006915; P:apoptotic process; IEA:UniProtKB-KW.
GO; GO:0042100; P:B cell proliferation; IDA:MGI.
GO; GO:0001568; P:blood vessel development; IMP:MGI.
GO; GO:0048514; P:blood vessel morphogenesis; IMP:MGI.
GO; GO:0030154; P:cell differentiation; IEA:UniProtKB-KW.
GO; GO:0071425; P:hematopoietic stem cell proliferation; IMP:MGI.
GO; GO:0030097; P:hemopoiesis; IMP:MGI.
GO; GO:1900194; P:negative regulation of oocyte maturation; IMP:MGI.
GO; GO:0006469; P:negative regulation of protein kinase activity; IMP:MGI.
GO; GO:0045931; P:positive regulation of mitotic cell cycle; IMP:MGI.
GO; GO:0045624; P:positive regulation of T-helper cell differentiation; IMP:MGI.
GO; GO:0050852; P:T cell receptor signaling pathway; IMP:MGI.
CDD; cd10389; SH2_SHB; 1.
Gene3D; 3.30.505.10; -; 1.
InterPro; IPR000980; SH2.
InterPro; IPR036860; SH2_dom_sf.
InterPro; IPR035040; SHB.
InterPro; IPR035045; SHB_SH2.
PANTHER; PTHR15127:SF31; PTHR15127:SF31; 1.
Pfam; PF00017; SH2; 1.
PRINTS; PR00401; SH2DOMAIN.
SMART; SM00252; SH2; 1.
SUPFAM; SSF55550; SSF55550; 1.
PROSITE; PS50001; SH2; 1.
1: Evidence at protein level;
Alternative splicing; Angiogenesis; Apoptosis; Cell membrane; Cytoplasm;
Developmental protein; Differentiation; Isopeptide bond; Membrane;
Phosphoprotein; Reference proteome; SH2 domain; Ubl conjugation.
CHAIN 1..503
/note="SH2 domain-containing adapter protein B"
/id="PRO_0000246325"
DOMAIN 404..498
/note="SH2"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"
MOD_RES 101
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q15464"
MOD_RES 301
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q15464"
MOD_RES 311
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q15464"
MOD_RES 382
/note="Phosphoserine"
/evidence="ECO:0000244|PubMed:19144319,
ECO:0000244|PubMed:21183079"
CROSSLNK 186
/note="Glycyl lysine isopeptide (Lys-Gly) (interchain with
G-Cter in SUMO2)"
/evidence="ECO:0000250|UniProtKB:Q15464"
VAR_SEQ 1..262
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:16141072"
/id="VSP_019848"
VAR_SEQ 443..479
/note="KSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYY -> NYADPEAVCAM
PILPRTARPSVRPSVHPSVRKICARR (in isoform 2)"
/evidence="ECO:0000303|PubMed:16141072"
/id="VSP_019849"
VAR_SEQ 480..503
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:16141072"
/id="VSP_019850"
SEQUENCE 503 AA; 54708 MW; 9A668DFC429F41E3 CRC64;
MAKWLNKYFS LGNSKTKSPP QPPRPDYREQ RRRGERREQP PQAVPQACSA SSASCGSAAA
CFSASSGSLP DDSGSTSDLI RAYRAQKERD FEDPYNGPGS SLRKLRAMCR LDYCGGGGGG
DPGGGQRAFT AAAGAAGCCC AAAGAGAAAS SSSSSGSPHL YRSSSERRPT TPAEVRYISP
KHRLIKVESA SAAGDPPGGV CSGGRTWSPT TCGGKKLLNK CSAEETGAGQ KDKVTIADDY
SDPFDAKSDL KSKAGKGESA GYMEPYEAQR IMTEFQRQES VRSQHKGIQL YDTPYEPEGQ
SVDSDSESTV SLRLRESKLP QDDDRPADEY DQPWEWNRVT IPALAAQFNG NEKRQSSPSP
SRDRRRQLRA PGGGFKPIKH GSPEFCGILG ERVDPTIPLE KQIWYHGAIS RSDAENLLRL
CKECSYLVRN SQTSKHDYSL SLKSNQGFMH MKLAKTKEKY VLGQNSPPFD SVPEVIHYYT
TRKLPIKGAE HLSLLYPVAV RTL


Related products :

Catalog number Product name Quantity
EIAAB41674 Mouse,Mus musculus,Ticam1,TICAM-1,TIR domain-containing adapter molecule 1,TIR domain-containing adapter protein inducing IFN-beta,Toll-interleukin-1 receptor domain-containing adapter protein inducin
EIAAB42483 Adaptor protein Wyatt,Homo sapiens,Human,MAL,MyD88 adapter-like protein,TIR domain-containing adapter protein,TIRAP,Toll_interleukin-1 receptor domain-containing adapter protein
EIAAB42482 Adaptor protein Wyatt,Mal,Mouse,Mus musculus,MyD88 adapter-like protein,TIR domain-containing adapter protein,Tirap,Toll_interleukin-1 receptor domain-containing adapter protein
EIAAB41675 Bos taurus,Bovine,TICAM1,TICAM-1,TIR domain-containing adapter molecule 1,TIR domain-containing adapter protein inducing IFN-beta,Toll-interleukin-1 receptor domain-containing adapter protein inducing
18-661-15155 Toll-interleukin 1 receptor domain-containing adapter protein - TIR domain-containing adapter protein; MyD88 adapter-like protein; Adaptor protein Wyatt Polyclonal 0.1 mg
18-661-15156 Toll-interleukin 1 receptor domain-containing adapter protein - TIR domain-containing adapter protein; MyD88 adapter-like protein; Adaptor protein Wyatt Polyclonal 0.1 mg
E1600h ELISA BASH,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,BLNK,Cytoplasmic adapter protein,Homo sapiens,Human,SLP65,SLP- 96T
E1600h ELISA kit BASH,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,BLNK,Cytoplasmic adapter protein,Homo sapiens,Human,SLP65 96T
U1600h CLIA BASH,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,BLNK,Cytoplasmic adapter protein,Homo sapiens,Human,SLP65,SLP-6 96T
E1600m ELISA kit Bash,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,Blnk,Cytoplasmic adapter protein,Ly57,Lymphocyte antigen 96T
E1600m ELISA Bash,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,Blnk,Cytoplasmic adapter protein,Ly57,Lymphocyte antigen 57,Mo 96T
U1600m CLIA Bash,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,Blnk,Cytoplasmic adapter protein,Ly57,Lymphocyte antigen 57,Mou 96T
EIAAB38183 Homo sapiens,Human,SCAP,SH2 domain-containing adapter protein,SH2 domain-containing protein 2A,SH2D2A,T cell-specific adapter protein,TSAd,TSAD,VEGF receptor-associated protein,VRAP
EIAAB38195 Adapter protein with pleckstrin homology and Src homology 2 domains,APS,Homo sapiens,Human,SH2 and PH domain-containing adapter protein APS,SH2B adapter protein 2,SH2B2
EIAAB38193 Adapter protein with pleckstrin homology and Src homology 2 domains,Aps,Rat,Rattus norvegicus,SH2 and PH domain-containing adapter protein APS,SH2B adapter protein 2,Sh2b2
EIAAB38194 Adapter protein with pleckstrin homology and Src homology 2 domains,Aps,Mouse,Mus musculus,SH2 and PH domain-containing adapter protein APS,SH2B adapter protein 2,Sh2b2
18-272-196229 BLNK - Rabbit polyclonal to BLNK; Cytoplasmic adapter protein; B-cell adapter containing SH2 domain protein; B-cell adapter containing Src homology 2 domain protein; Src homology 2 domain-containing l 0.1 mg
EIAAB31262 FAPP1,FAPP-1,Homo sapiens,Human,PH domain-containing family A member 3,Phosphatidylinositol-four-phosphate adapter protein 1,Phosphoinositol 4-phosphate adapter protein 1,Pleckstrin homology domain-co
EIAAB31273 Fapp2,FAPP-2,Mouse,Mus musculus,PH domain-containing family A member 8,Phosphatidylinositol-four-phosphate adapter protein 2,Phosphoinositol 4-phosphate adapter protein 2,Pleckstrin homology domain-co
EIAAB31263 Fapp1,FAPP-1,Mouse,Mus musculus,PH domain-containing family A member 3,Phosphatidylinositol-four-phosphate adapter protein 1,Phosphoinositol 4-phosphate adapter protein 1,Pleckstrin homology domain-co
18-661-15184 TRIF-related adapter molecule - TICAM2 protein; TIRAP3a; TIRAP3a short form; TIR-containing adapter molecule-2; TIR domain-containing adapter protein; Putative NFkB activating protein Polyclonal 0.1 mg
18-661-15165 TRIF-related adapter molecule - TICAM2 protein; TIRAP3a; TIRAP3a short form; TIR-containing adapter molecule-2; TIR domain-containing adapter protein; Putative NFkB activating protein Polyclonal 0.1 mg
E1600c ELISA BASH,B-cell adapter SH2 domain-containing protein,B-cell linker protein,BLNK,Chicken,Cytoplasmic adapter protein,Gallus gallus,SLP-65,Src homology 2 domain-containing leukocyte protein of 65 kDa 96T
E1600c ELISA kit BASH,B-cell adapter SH2 domain-containing protein,B-cell linker protein,BLNK,Chicken,Cytoplasmic adapter protein,Gallus gallus,SLP-65,Src homology 2 domain-containing leukocyte protein of 6 96T
U1600c CLIA BASH,B-cell adapter SH2 domain-containing protein,B-cell linker protein,BLNK,Chicken,Cytoplasmic adapter protein,Gallus gallus,SLP-65,Src homology 2 domain-containing leukocyte protein of 65 kDa 96T
Pathways :
WP1689: Porphyrin and chlorophyll metabolism
WP1700: Selenoamino acid metabolism
WP1438: Influenza A virus infection
WP1502: Mitochondrial biogenesis
WP1673: Naphthalene and anthracene degradation
WP346: Protein Modifications
WP211: BMP signaling pathway
WP1625: Base excision repair
WP2218: sGC
WP1654: gamma-Hexachlorocyclohexane degradation
WP1714: Tyrosine metabolism
WP1493: Carbon assimilation C4 pathway
WP1566: Citrate cycle (TCA cycle)
WP210: Cytoplasmic Ribosomal Proteins
WP1624: Bacterial secretion system
WP2292: Chemokine signaling pathway
WP1713: Two-component system
WP1531: Vitamin D synthesis
WP2032: TSH signaling pathway
WP2199: Seed Development
WP1685: Peptidoglycan biosynthesis
WP1616: ABC transporters
WP731: Sterol regulatory element binding protein related
WP2324: AGE/RAGE pathway
WP196: Glutathione Biosynthesis

Related Genes :

Bibliography :
[31527084] Phosphorylation of the multifunctional signal transducer B-cell adaptor protein (BCAP) promotes recruitment of multiple SH2/SH3 proteins including GRB2.
[30659097] Hepatitis B virus X protein-induced SH2 domain-containing 5 (SH2D5) expression promotes hepatoma cell growth via an SH2D5-transketolase interaction.
[29503347] Protein Tyrosine Phosphatase SHP-2 Is Involved in the Interleukin-21-Induced Activation of Extracellular Signal-Regulated Kinase 1/2.
[28526413] TCR crosslinking promotes Crk adaptor protein binding to tyrosine-phosphorylated CD3ζ chain.
[28465009] Crk adaptor proteins regulate CD3ζ chain phosphorylation and TCR/CD3 down-modulation in activated T cells.
[28030426] Meta-analysis of genome-wide association studies on the intolerance of angiotensin-converting enzyme inhibitors.
[27813071] What goes up must come down: A tripartite Dok-3/Grb2/SHIP1 inhibitory module limits BCR signaling.
[27550373] The Dok-3/Grb2 adaptor module promotes inducible association of the lipid phosphatase SHIP with the BCR in a coreceptor-independent manner.
[27605668] Up-regulation of N-cadherin by Collagen I-activated Discoidin Domain Receptor 1 in Pancreatic Cancer Requires the Adaptor Molecule Shc1.
[27459314] Overexpression of Lnk in the Ovaries Is Involved in Insulin Resistance in Women With Polycystic Ovary Syndrome.