GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

SH3 domain-containing kinase-binding protein 1 (CD2-binding protein 3) (CD2BP3) (Cbl-interacting protein of 85 kDa) (Human Src family kinase-binding protein 1) (HSB-1)

 SH3K1_HUMAN             Reviewed;         665 AA.
Q96B97; B7Z1D5; Q5JPT4; Q5JPT5; Q8IWX6; Q8IX98; Q96RN4; Q9NYR0;
23-MAY-2003, integrated into UniProtKB/Swiss-Prot.
23-MAY-2003, sequence version 2.
03-JUL-2019, entry version 176.
RecName: Full=SH3 domain-containing kinase-binding protein 1;
AltName: Full=CD2-binding protein 3;
Short=CD2BP3;
AltName: Full=Cbl-interacting protein of 85 kDa;
AltName: Full=Human Src family kinase-binding protein 1;
Short=HSB-1;
Name=SH3KBP1; Synonyms=CIN85;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND INTERACTION WITH CBL.
PubMed=10679202; DOI=10.1006/bbrc.2000.2147;
Take H., Watanabe S., Takeda K., Yu Z.-X., Iwata N., Kajigaya S.;
"Cloning and characterization of a novel adaptor protein, CIN85, that
interacts with c-Cbl.";
Biochem. Biophys. Res. Commun. 268:321-328(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
TISSUE=T-cell;
PubMed=12618476; DOI=10.1093/intimm/dxg032;
Tibaldi E.V., Reinherz E.L.;
"CD2BP3, CIN85 and the structurally related adaptor protein CMS bind
to the same CD2 cytoplasmic segment but elicit divergent functional
activities.";
Int. Immunol. 15:313-329(2003).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15772651; DOI=10.1038/nature03440;
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D.,
Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A.,
Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G.,
Jones M.C., Hurles M.E., Andrews T.D., Scott C.E., Searle S.,
Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R.,
Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L.,
Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A.,
Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S.,
Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R.,
Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M.,
Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N.,
Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D.,
Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W.,
Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C.,
Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C.,
Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S.,
Corby N., Connor R.E., David R., Davies J., Davis C., Davis J.,
Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S.,
Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I.,
Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L.,
Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P.,
Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S.,
Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A.,
Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J.,
Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J.,
Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S.,
de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z.,
Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C.,
Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W.,
Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D.,
Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H.,
McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T.,
Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I.,
Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N.,
Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J.,
Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E.,
Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S.,
Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K.,
Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D.,
Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R.,
Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T.,
Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S.,
Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L.,
Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A.,
Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L.,
Williams G., Williams L., Williamson A., Williamson H., Wilming L.,
Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H.,
Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A.,
Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F.,
Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A.,
Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T.,
Gibbs R.A., Beck S., Rogers J., Bentley D.R.;
"The DNA sequence of the human X chromosome.";
Nature 434:325-337(2005).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Adrenal cortex, and Uterus;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
NUCLEOTIDE SEQUENCE [MRNA] OF 262-665, AND VARIANT LEU-382.
PubMed=11474197;
Narita T., Amano F., Yoshizaki K., Nishimoto N., Nishimura T.,
Tajima T., Namiki H., Taniyama T.;
"Assignment of SH3KBP1 to human chromosome band Xp22.1-->p21.3 by in
situ hybridization.";
Cytogenet. Cell Genet. 93:133-134(2001).
[7]
INTERACTION WITH BLNK; CRK; BCAR1; PIK3R3; GRB2 AND SOS1, AND
SELF-ASSOCIATION.
PubMed=11071869; DOI=10.1006/bbrc.2000.3760;
Watanabe S., Take H., Takeda K., Yu Z.X., Iwata N., Kajigaya S.;
"Characterization of the CIN85 adaptor protein and identification of
components involved in CIN85 complexes.";
Biochem. Biophys. Res. Commun. 278:167-174(2000).
[8]
INTERACTION WITH CBLB AND ENDOPHILINS, LACK OF INTERACTION WITH CBLC,
FUNCTION IN RECEPTOR INTERNALIZATION, AND SUBCELLULAR LOCATION.
PubMed=12177062; DOI=10.1074/jbc.M205535200;
Szymkiewicz I., Kowanetz K., Soubeyran P., Dinarina A., Lipkowitz S.,
Dikic I.;
"CIN85 participates in Cbl-b-mediated down-regulation of receptor
tyrosine kinases.";
J. Biol. Chem. 277:39666-39672(2002).
[9]
FUNCTION IN RECEPTOR INTERNALIZATION, INTERACTION WITH EGFR; SH3GL1;
SH3GL2; SH3GL3 AND CBL, AND SUBCELLULAR LOCATION.
PubMed=11894095; DOI=10.1038/416183a;
Soubeyran P., Kowanetz K., Szymkiewicz I., Langdon W.Y., Dikic I.;
"Cbl-CIN85-endophilin complex mediates ligand-induced downregulation
of EGF receptors.";
Nature 416:183-187(2002).
[10]
FUNCTION IN RECEPTOR INTERNALIZATION, AND INTERACTION WITH SH3GL1;
SH3GL2; SH3GL3; CBL AND MET.
PubMed=11894096; DOI=10.1038/416187a;
Petrelli A., Gilestro G.F., Lanzardo S., Comoglio P.M., Migone N.,
Giordano S.;
"The endophilin-CIN85-Cbl complex mediates ligand-dependent
downregulation of c-Met.";
Nature 416:187-190(2002).
[11]
UBIQUITINATION BY CBL AND CBLB.
PubMed=12218189; DOI=10.1073/pnas.192462299;
Haglund K., Shimokawa N., Szymkiewicz I., Dikic I.;
"Cbl-directed monoubiquitination of CIN85 is involved in regulation of
ligand-induced degradation of EGF receptors.";
Proc. Natl. Acad. Sci. U.S.A. 99:12191-12196(2002).
[12]
INTERACTION WITH DAB2, AND IDENTIFICATION IN A COMPLEX WITH DAB2 AND
CLATHRIN.
PubMed=14596919; DOI=10.1016/S0014-5793(03)01111-6;
Kowanetz K., Terzic J., Dikic I.;
"Dab2 links CIN85 with clathrin-mediated receptor internalization.";
FEBS Lett. 554:81-87(2003).
[13]
FUNCTION IN CELL ADHESION, AND INTERACTION WITH PDCD6IP; PTK2/FAK1 AND
PTK2B/PYK2.
PubMed=12771190; DOI=10.1242/jcs.00522;
Schmidt M.H., Chen B., Randazzo L.M., Boegler O.;
"SETA/CIN85/Ruk and its binding partner AIP1 associate with diverse
cytoskeletal elements, including FAKs, and modulate cell adhesion.";
J. Cell Sci. 116:2845-2855(2003).
[14]
INTERACTION WITH CD2 AND F-ACTIN CAPPING PROTEIN.
PubMed=12690097; DOI=10.1074/jbc.M302540200;
Hutchings N.J., Clarkson N., Chalkley R., Barclay A.N., Brown M.H.;
"Linking the T cell surface protein CD2 to the actin-capping protein
CAPZ via CMS and CIN85.";
J. Biol. Chem. 278:22396-22403(2003).
[15]
FUNCTION IN RECEPTOR INTERNALIZATION.
PubMed=12734385; DOI=10.1073/pnas.1031790100;
Schmidt M.H., Furnari F.B., Cavenee W.K., Bogler O.;
"Epidermal growth factor receptor signaling intensity determines
intracellular protein interactions, ubiquitination, and
internalization.";
Proc. Natl. Acad. Sci. U.S.A. 100:6505-6510(2003).
[16]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=15144186; DOI=10.1021/ac035352d;
Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M.,
Peters E.C.;
"Robust phosphoproteomic profiling of tyrosine phosphorylation sites
from human T cells using immobilized metal affinity chromatography and
tandem mass spectrometry.";
Anal. Chem. 76:2763-2772(2004).
[17]
FUNCTION IN RECEPTOR INTERNALIZATION, INTERACTION WITH ASAP1; ARAP3;
HIP1R; SYNJ2; INPP5D; STAP1 AND EGFR, IDENTIFICATION IN A COMPLEX WITH
ASAP1 AND ARAP3, AND SUBCELLULAR LOCATION.
PubMed=15090612; DOI=10.1091/mbc.E03-09-0683;
Kowanetz K., Husnjak K., Holler D., Kowanetz M., Soubeyran P.,
Hirsch D., Schmidt M.H., Pavelic K., De Camilli P., Randazzo P.A.,
Dikic I.;
"CIN85 associates with multiple effectors controlling intracellular
trafficking of epidermal growth factor receptors.";
Mol. Biol. Cell 15:3155-3166(2004).
[18]
INTERACTION WITH PDCD6IP; EGFR; CBL AND CBLB.
PubMed=15456872; DOI=10.1128/MCB.24.20.8981-8993.2004;
Schmidt M.H., Hoeller D., Yu J., Furnari F.B., Cavenee W.K., Dikic I.,
Bogler O.;
"Alix/AIP1 antagonizes epidermal growth factor receptor downregulation
by the Cbl-SETA/CIN85 complex.";
Mol. Cell. Biol. 24:8981-8993(2004).
[19]
FUNCTION, AND INTERACTION WITH MAP3K4.
PubMed=16256071; DOI=10.1016/j.bbrc.2005.10.032;
Aissouni Y., Zapart G., Iovanna J.L., Dikic I., Soubeyran P.;
"CIN85 regulates the ability of MEKK4 to activate the p38 MAP kinase
pathway.";
Biochem. Biophys. Res. Commun. 338:808-814(2005).
[20]
INTERACTION WITH SPRY2.
PubMed=15962011; DOI=10.1038/sj.embor.7400453;
Haglund K., Schmidt M.H., Wong E.S., Guy G.R., Dikic I.;
"Sprouty2 acts at the Cbl/CIN85 interface to inhibit epidermal growth
factor receptor downregulation.";
EMBO Rep. 6:635-641(2005).
[21]
FUNCTION IN APOPTOSIS, AND INTERACTION WITH SRC; LCK; LYN; FGR; FYN;
HCK; TRADD; BIRC2; TRAF1; TRAF2 AND TNFR1.
PubMed=15707590; DOI=10.1016/j.yexcr.2004.11.005;
Narita T., Nishimura T., Yoshizaki K., Taniyama T.;
"CIN85 associates with TNF receptor 1 via Src and modulates TNF-alpha-
induced apoptosis.";
Exp. Cell Res. 304:256-264(2005).
[22]
FUNCTION IN RECEPTOR INTERNALIZATION.
PubMed=16177060; DOI=10.4049/jimmunol.175.7.4208;
Molfetta R., Belleudi F., Peruzzi G., Morrone S., Leone L., Dikic I.,
Piccoli M., Frati L., Torrisi M.R., Santoni A., Paolini R.;
"CIN85 regulates the ligand-dependent endocytosis of the IgE receptor:
a new molecular mechanism to dampen mast cell function.";
J. Immunol. 175:4208-4216(2005).
[23]
INTERACTION WITH ARHGAP17.
PubMed=16678097; DOI=10.1016/j.cell.2006.02.045;
Wells C.D., Fawcett J.P., Traweger A., Yamanaka Y., Goudreault M.,
Elder K., Kulkarni S., Gish G., Virag C., Lim C., Colwill K.,
Starostine A., Metalnikov P., Pawson T.;
"A Rich1/Amot complex regulates the Cdc42 GTPase and apical-polarity
proteins in epithelial cells.";
Cell 125:535-548(2006).
[24]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=17081983; DOI=10.1016/j.cell.2006.09.026;
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,
Mann M.;
"Global, in vivo, and site-specific phosphorylation dynamics in
signaling networks.";
Cell 127:635-648(2006).
[25]
INTERACTION WITH DDN AND MAGI2, AND SUBCELLULAR LOCATION.
PubMed=16751601; DOI=10.1093/jb/mvj105;
Kawata A., Iida J., Ikeda M., Sato Y., Mori H., Kansaku A., Sumita K.,
Fujiwara N., Rokukawa C., Hamano M., Hirabayashi S., Hata Y.;
"CIN85 is localized at synapses and forms a complex with S-SCAM via
dendrin.";
J. Biochem. 139:931-939(2006).
[26]
INTERACTION WITH MVB12A.
PubMed=16895919; DOI=10.1074/jbc.M605693200;
Konishi H., Tashiro K., Murata Y., Nabeshi H., Yamauchi E.,
Taniguchi H.;
"CFBP is a novel tyrosine-phosphorylated protein that might function
as a regulator of CIN85/CD2AP.";
J. Biol. Chem. 281:28919-28931(2006).
[27]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=T-cell;
PubMed=19367720; DOI=10.1021/pr800500r;
Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J.;
"Phosphorylation analysis of primary human T lymphocytes using
sequential IMAC and titanium oxide enrichment.";
J. Proteome Res. 7:5167-5176(2008).
[28]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-254; SER-436; SER-509;
SER-511; SER-521 AND SER-587, AND IDENTIFICATION BY MASS SPECTROMETRY
[LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[29]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
[30]
INTERACTION WITH MAP3K4 AND ZFP36, AND SUBCELLULAR LOCATION.
PubMed=20221403; DOI=10.1371/journal.pone.0009588;
Kedar V.P., Darby M.K., Williams J.G., Blackshear P.J.;
"Phosphorylation of human tristetraprolin in response to its
interaction with the Cbl interacting protein CIN85.";
PLoS ONE 5:E9588-E9588(2010).
[31]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230; SER-436 AND
SER-587, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
Mann M.;
"Quantitative phosphoproteomics reveals widespread full
phosphorylation site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[32]
FUNCTION.
PubMed=21834987; DOI=10.1186/1741-7007-9-54;
Bai S.W., Herrera-Abreu M.T., Rohn J.L., Racine V., Tajadura V.,
Suryavanshi N., Bechtel S., Wiemann S., Baum B., Ridley A.J.;
"Identification and characterization of a set of conserved and new
regulators of cytoskeletal organisation, cell morphology and
migration.";
BMC Biol. 9:54-54(2011).
[33]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[34]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21406692; DOI=10.1126/scisignal.2001570;
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J.,
Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V.,
Blagoev B.;
"System-wide temporal characterization of the proteome and
phosphoproteome of human embryonic stem cell differentiation.";
Sci. Signal. 4:RS3-RS3(2011).
[35]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230; THR-254; SER-436
AND SER-587, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[36]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-183; SER-509 AND
SER-511, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[37]
X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1-58 IN COMPLEX WITH CBLB.
PubMed=16228008; DOI=10.1038/nsmb1000;
Jozic D., Cardenes N., Deribe Y.L., Moncalian G., Hoeller D.,
Groemping Y., Dikic I., Rittinger K., Bravo J.;
"Cbl promotes clustering of endocytic adaptor proteins.";
Nat. Struct. Mol. Biol. 12:972-979(2005).
-!- FUNCTION: Adapter protein involved in regulating diverse signal
transduction pathways. Involved in the regulation of endocytosis
and lysosomal degradation of ligand-induced receptor tyrosine
kinases, including EGFR and MET/hepatocyte growth factor receptor,
through an association with CBL and endophilins. The association
with CBL, and thus the receptor internalization, may be inhibited
by an interaction with PDCD6IP and/or SPRY2. Involved in
regulation of ligand-dependent endocytosis of the IgE receptor.
Attenuates phosphatidylinositol 3-kinase activity by interaction
with its regulatory subunit (By similarity). May be involved in
regulation of cell adhesion; promotes the interaction between
TTK2B and PDCD6IP. May be involved in the regulation of cellular
stress response via the MAPK pathways through its interaction with
MAP3K4. Is involved in modulation of tumor necrosis factor
mediated apoptosis. Plays a role in the regulation of cell
morphology and cytoskeletal organization. Required in the control
of cell shape and migration. {ECO:0000250,
ECO:0000269|PubMed:11894095, ECO:0000269|PubMed:11894096,
ECO:0000269|PubMed:12177062, ECO:0000269|PubMed:12734385,
ECO:0000269|PubMed:12771190, ECO:0000269|PubMed:15090612,
ECO:0000269|PubMed:15707590, ECO:0000269|PubMed:16177060,
ECO:0000269|PubMed:16256071, ECO:0000269|PubMed:21834987}.
-!- SUBUNIT: Can self-associate and form homotetramers. Interacts with
CD2, F-actin capping protein, PIK3R3, GRB2, EGFR, MET, BLNK,
MAP3K4, PDCD6IP, SPRY2, ARHGAP17, ARHGAP27, MAGI2, CRK, BCAR1,
SOS1, ASAP1, ARAP3, HIP1R, SYNJ2, INPP5D and STAP1. Interacts with
CBL and CBLB, but does not interact with CBLC. Two molecules of
SH3KBP1 seem to bind through their respective SH3 1 domain to one
molecule of CBLB. The interaction with CBL or CBLB and EGFR is
increased upon EGF stimulation. The interaction with CBL is
attenuated by PDCD6IP. Interacts through its proline-rich region
with the SH3 domain of endophilins SH3GL1, SH3GL2 and SH3GL3. The
SH3KBP1-endophilin complex seems to associate with a complex
containing the phosphorylated receptor (EGFR or MET) and
phosphorylated CBL. Probably associates with ASAP1 and
phosphorylated EGFR. Probably part of a complex consisting of at
least SH3KBP1, ASAP1 and ARAP3. Interacts with focal adhesion
kinases PTK2/FAK1 AND PTK2B/PYK2, probably as a dimer. Interacts
with DAB2 and probably associates with chathrin through its
interaction with DAB2. Part of a complex consisting of SH3KBP1,
DAB2, and clathrin heavy chain. DAB2 and clathrin dissociate from
SH3KBP1 following growth factor treatment, enabling interaction
with CBL. Interacts with DDN and probably associates with MAGI2
through its interaction with DDN. Interacts with the SH3 domains
of SRC tyrosine-protein kinases SRC, LCK, LYN, FGR, FYN and HCK.
Interacts with TRADD, BIRC2, TRAF1, TRAF2 and TNFR1, and the
association with a TNFR1-associated complex upon stimulation with
TNF-alpha seems to be mediated by SRC. Interacts (via SH3 domains)
with SHKBP1 (via PXXXPR motifs) (By similarity). Interaction with
CBL is abolished in the presence of SHKBP1 (By similarity).
Interacts (via SH3 domains) with ZFP36 (via extreme C-terminal
region) (PubMed:20221403). Interacts with MAP3K4; this interaction
enhances the association with ZFP36 (PubMed:20221403).
{ECO:0000250|UniProtKB:Q8R550, ECO:0000269|PubMed:10679202,
ECO:0000269|PubMed:11071869, ECO:0000269|PubMed:11894095,
ECO:0000269|PubMed:11894096, ECO:0000269|PubMed:12177062,
ECO:0000269|PubMed:12690097, ECO:0000269|PubMed:12771190,
ECO:0000269|PubMed:14596919, ECO:0000269|PubMed:15090612,
ECO:0000269|PubMed:15456872, ECO:0000269|PubMed:15707590,
ECO:0000269|PubMed:15962011, ECO:0000269|PubMed:16228008,
ECO:0000269|PubMed:16256071, ECO:0000269|PubMed:16678097,
ECO:0000269|PubMed:16751601, ECO:0000269|PubMed:16895919,
ECO:0000269|PubMed:20221403}.
-!- INTERACTION:
Q8WWN8:ARAP3; NbExp=2; IntAct=EBI-346595, EBI-4402732;
Q9ULH1:ASAP1; NbExp=8; IntAct=EBI-346595, EBI-346622;
P52907:CAPZA1; NbExp=2; IntAct=EBI-346595, EBI-355586;
P22681:CBL; NbExp=18; IntAct=EBI-346595, EBI-518228;
Q13191:CBLB; NbExp=21; IntAct=EBI-346595, EBI-744027;
Q13191-1:CBLB; NbExp=3; IntAct=EBI-7585212, EBI-15555129;
P06729:CD2; NbExp=3; IntAct=EBI-346595, EBI-3912464;
P98078:Dab2 (xeno); NbExp=9; IntAct=EBI-346595, EBI-1391846;
O94850:DDN; NbExp=5; IntAct=EBI-346595, EBI-5240523;
P50570:DNM2; NbExp=5; IntAct=EBI-346595, EBI-346547;
P39052:Dnm2 (xeno); NbExp=4; IntAct=EBI-346595, EBI-349613;
Q86UU5:GGN; NbExp=4; IntAct=EBI-346595, EBI-10259069;
Q9JKY5:Hip1r (xeno); NbExp=3; IntAct=EBI-346595, EBI-642457;
Q92835:INPP5D; NbExp=6; IntAct=EBI-346595, EBI-1380477;
Q9Y6R4:MAP3K4; NbExp=5; IntAct=EBI-346595, EBI-448104;
P78314:SH3BP2; NbExp=8; IntAct=EBI-346595, EBI-727062;
Q99962:SH3GL2; NbExp=2; IntAct=EBI-346595, EBI-77938;
O43597:SPRY2; NbExp=2; IntAct=EBI-346595, EBI-742487;
Q13501:SQSTM1; NbExp=4; IntAct=EBI-346595, EBI-307104;
Q9ULZ2:STAP1; NbExp=4; IntAct=EBI-346595, EBI-6083058;
O15056:SYNJ2; NbExp=3; IntAct=EBI-346595, EBI-310513;
P0CG48:UBC; NbExp=6; IntAct=EBI-346595, EBI-3390054;
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:20221403}.
Cytoplasm, cytoskeleton. Cytoplasmic vesicle membrane; Peripheral
membrane protein. Cell junction, synapse, synaptosome. Cell
junction, focal adhesion {ECO:0000250}. Note=Localized in
endocytic vesicles containing clustered receptors. Colocalizes
with ASAP1 in vesicular structures. Colocalized with actin
microfilaments and focal adhesions (By similarity). Colocalized
with MAGI2 in synaptosomes. Translocation to EGFR containing
vesicles upon EGF stimulation is inhibited in the presence of
SH3KBP1 (By similarity). Colocalizes with ZFP36 in the cytoplasm
(PubMed:20221403). {ECO:0000250|UniProtKB:Q8R550,
ECO:0000269|PubMed:20221403}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q96B97-1; Sequence=Displayed;
Note=Interacts with CBL.;
Name=2;
IsoId=Q96B97-2; Sequence=VSP_007504;
Note=Interacts with CD2 cytoplasmic tail and does not interact
with F-actin.;
Name=3;
IsoId=Q96B97-3; Sequence=VSP_044655, VSP_044656;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Ubiquitously expressed. Also expressed in some
cancer cell lines.
-!- PTM: Monoubiquitinated by CBL and CBLB after EGF stimulation;
probably on its C-terminus.
-!- SEQUENCE CAUTION:
Sequence=AAH50663.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF230904; AAF37854.1; -; mRNA.
EMBL; AF542051; AAN77231.1; -; mRNA.
EMBL; AK293234; BAH11470.1; -; mRNA.
EMBL; AK293237; BAH11471.1; -; mRNA.
EMBL; AL732423; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL732327; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL732325; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL732409; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL772197; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC015806; AAH15806.1; -; mRNA.
EMBL; BC050663; AAH50663.1; ALT_SEQ; mRNA.
EMBL; AF329267; AAK95587.1; -; mRNA.
EMBL; AF329268; AAO13348.1; -; mRNA.
CCDS; CCDS14193.1; -. [Q96B97-1]
CCDS; CCDS35213.1; -. [Q96B97-2]
CCDS; CCDS55383.1; -. [Q96B97-3]
PIR; JC7191; JC7191.
RefSeq; NP_001019837.1; NM_001024666.2. [Q96B97-2]
RefSeq; NP_001171889.1; NM_001184960.1. [Q96B97-3]
RefSeq; NP_114098.1; NM_031892.2. [Q96B97-1]
RefSeq; XP_016884958.1; XM_017029469.1.
PDB; 2BZ8; X-ray; 2.00 A; A/B=1-58.
PDB; 2K6D; NMR; -; A=267-328.
PDB; 2K9G; NMR; -; A=262-333.
PDB; 2N64; NMR; -; A/B/C=594-665.
PDB; 2O2O; NMR; -; A=92-168.
PDB; 2YDL; X-ray; 2.05 A; A=270-328.
PDB; 5ABS; X-ray; 1.74 A; A=599-662.
PDBsum; 2BZ8; -.
PDBsum; 2K6D; -.
PDBsum; 2K9G; -.
PDBsum; 2N64; -.
PDBsum; 2O2O; -.
PDBsum; 2YDL; -.
PDBsum; 5ABS; -.
SMR; Q96B97; -.
BioGrid; 119029; 275.
CORUM; Q96B97; -.
DIP; DIP-31803N; -.
IntAct; Q96B97; 63.
MINT; Q96B97; -.
STRING; 9606.ENSP00000380921; -.
iPTMnet; Q96B97; -.
PhosphoSitePlus; Q96B97; -.
BioMuta; SH3KBP1; -.
DMDM; 31077034; -.
EPD; Q96B97; -.
jPOST; Q96B97; -.
MaxQB; Q96B97; -.
PaxDb; Q96B97; -.
PeptideAtlas; Q96B97; -.
PRIDE; Q96B97; -.
ProteomicsDB; 76057; -.
ProteomicsDB; 76058; -. [Q96B97-2]
DNASU; 30011; -.
Ensembl; ENST00000379698; ENSP00000369020; ENSG00000147010. [Q96B97-2]
Ensembl; ENST00000379716; ENSP00000369039; ENSG00000147010. [Q96B97-3]
Ensembl; ENST00000397821; ENSP00000380921; ENSG00000147010. [Q96B97-1]
GeneID; 30011; -.
KEGG; hsa:30011; -.
UCSC; uc004czl.4; human. [Q96B97-1]
CTD; 30011; -.
DisGeNET; 30011; -.
GeneCards; SH3KBP1; -.
HGNC; HGNC:13867; SH3KBP1.
HPA; CAB021892; -.
HPA; HPA003351; -.
HPA; HPA003355; -.
MIM; 300374; gene.
neXtProt; NX_Q96B97; -.
OpenTargets; ENSG00000147010; -.
PharmGKB; PA37822; -.
eggNOG; KOG4348; Eukaryota.
eggNOG; ENOG410XQBY; LUCA.
GeneTree; ENSGT00940000155886; -.
HOGENOM; HOG000231405; -.
InParanoid; Q96B97; -.
KO; K12470; -.
OMA; PMHEVSS; -.
OrthoDB; 1577081at2759; -.
PhylomeDB; Q96B97; -.
TreeFam; TF350191; -.
Reactome; R-HSA-182971; EGFR downregulation.
Reactome; R-HSA-6807004; Negative regulation of MET activity.
Reactome; R-HSA-8856825; Cargo recognition for clathrin-mediated endocytosis.
Reactome; R-HSA-8856828; Clathrin-mediated endocytosis.
Reactome; R-HSA-8866376; Reelin signalling pathway.
Reactome; R-HSA-8875360; InlB-mediated entry of Listeria monocytogenes into host cell.
Reactome; R-HSA-983695; Antigen activates B Cell Receptor (BCR) leading to generation of second messengers.
SignaLink; Q96B97; -.
SIGNOR; Q96B97; -.
ChiTaRS; SH3KBP1; human.
EvolutionaryTrace; Q96B97; -.
GeneWiki; SH3KBP1; -.
GenomeRNAi; 30011; -.
PRO; PR:Q96B97; -.
Proteomes; UP000005640; Chromosome X.
Bgee; ENSG00000147010; Expressed in 208 organ(s), highest expression level in secondary oocyte.
ExpressionAtlas; Q96B97; baseline and differential.
Genevisible; Q96B97; HS.
GO; GO:0005911; C:cell-cell junction; IEA:Ensembl.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0030659; C:cytoplasmic vesicle membrane; IEA:UniProtKB-SubCell.
GO; GO:0005856; C:cytoskeleton; IEA:UniProtKB-SubCell.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0030139; C:endocytic vesicle; ISS:UniProtKB.
GO; GO:0005925; C:focal adhesion; IEA:UniProtKB-SubCell.
GO; GO:0043005; C:neuron projection; IEA:UniProtKB-SubCell.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0045202; C:synapse; IEA:UniProtKB-KW.
GO; GO:0017124; F:SH3 domain binding; IEA:UniProtKB-KW.
GO; GO:0007015; P:actin filament organization; IEA:InterPro.
GO; GO:0006915; P:apoptotic process; IEA:UniProtKB-KW.
GO; GO:0007411; P:axon guidance; TAS:Reactome.
GO; GO:0016477; P:cell migration; IMP:UniProtKB.
GO; GO:0007267; P:cell-cell signaling; NAS:UniProtKB.
GO; GO:0007010; P:cytoskeleton organization; IMP:UniProtKB.
GO; GO:0006897; P:endocytosis; IEA:UniProtKB-KW.
GO; GO:0061024; P:membrane organization; TAS:Reactome.
GO; GO:0042059; P:negative regulation of epidermal growth factor receptor signaling pathway; TAS:Reactome.
GO; GO:0008360; P:regulation of cell shape; IMP:UniProtKB.
CDD; cd12052; SH3_CIN85_1; 1.
CDD; cd12055; SH3_CIN85_2; 1.
CDD; cd12057; SH3_CIN85_3; 1.
InterPro; IPR035770; CIN85_SH3_1.
InterPro; IPR035771; CIN85_SH3_2.
InterPro; IPR035772; CIN85_SH3_3.
InterPro; IPR036028; SH3-like_dom_sf.
InterPro; IPR001452; SH3_domain.
InterPro; IPR028506; Sorbin_SH3.
PANTHER; PTHR14167:SF6; PTHR14167:SF6; 2.
Pfam; PF14604; SH3_9; 3.
PRINTS; PR00452; SH3DOMAIN.
SMART; SM00326; SH3; 3.
SUPFAM; SSF50044; SSF50044; 3.
PROSITE; PS50002; SH3; 3.
1: Evidence at protein level;
3D-structure; Alternative splicing; Apoptosis; Cell junction;
Coiled coil; Complete proteome; Cytoplasm; Cytoplasmic vesicle;
Cytoskeleton; Endocytosis; Membrane; Phosphoprotein; Polymorphism;
Reference proteome; Repeat; SH3 domain; SH3-binding; Synapse;
Synaptosome; Ubl conjugation.
CHAIN 1 665 SH3 domain-containing kinase-binding
protein 1.
/FTId=PRO_0000097728.
DOMAIN 1 58 SH3 1. {ECO:0000255|PROSITE-
ProRule:PRU00192}.
DOMAIN 98 157 SH3 2. {ECO:0000255|PROSITE-
ProRule:PRU00192}.
DOMAIN 267 328 SH3 3. {ECO:0000255|PROSITE-
ProRule:PRU00192}.
COILED 602 664 {ECO:0000255}.
COMPBIAS 327 428 Pro-rich.
MOD_RES 156 156 Phosphoserine.
{ECO:0000250|UniProtKB:Q8R550}.
MOD_RES 159 159 Phosphoserine.
{ECO:0000250|UniProtKB:Q8R550}.
MOD_RES 183 183 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 230 230 Phosphoserine.
{ECO:0000244|PubMed:15144186,
ECO:0000244|PubMed:17081983,
ECO:0000244|PubMed:19367720,
ECO:0000244|PubMed:19690332,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:21406692,
ECO:0000244|PubMed:23186163}.
MOD_RES 254 254 Phosphothreonine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:23186163}.
MOD_RES 436 436 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:23186163}.
MOD_RES 509 509 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:24275569}.
MOD_RES 511 511 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:24275569}.
MOD_RES 521 521 Phosphoserine.
{ECO:0000244|PubMed:18669648}.
MOD_RES 587 587 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:23186163}.
VAR_SEQ 1 54 MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQI
NGRRGLFPDNFVR -> MEVSAAKAPSAADLSEI (in
isoform 2). {ECO:0000303|PubMed:12618476,
ECO:0000303|PubMed:14702039}.
/FTId=VSP_007504.
VAR_SEQ 1 4 MVEA -> MGEE (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_044655.
VAR_SEQ 5 242 Missing (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_044656.
VARIANT 382 382 P -> L (in dbSNP:rs1310665369).
{ECO:0000269|PubMed:11474197}.
/FTId=VAR_015667.
CONFLICT 288 288 I -> T (in Ref. 3; BAH11471).
{ECO:0000305}.
CONFLICT 426 426 V -> A (in Ref. 3; BAH11471).
{ECO:0000305}.
CONFLICT 570 570 A -> V (in Ref. 5; AAH15806).
{ECO:0000305}.
STRAND 4 8 {ECO:0000244|PDB:2BZ8}.
STRAND 25 30 {ECO:0000244|PDB:2BZ8}.
TURN 33 35 {ECO:0000244|PDB:2BZ8}.
STRAND 36 41 {ECO:0000244|PDB:2BZ8}.
STRAND 44 49 {ECO:0000244|PDB:2BZ8}.
HELIX 50 52 {ECO:0000244|PDB:2BZ8}.
STRAND 53 55 {ECO:0000244|PDB:2BZ8}.
STRAND 102 105 {ECO:0000244|PDB:2O2O}.
STRAND 113 115 {ECO:0000244|PDB:2O2O}.
STRAND 124 126 {ECO:0000244|PDB:2O2O}.
HELIX 130 132 {ECO:0000244|PDB:2O2O}.
STRAND 149 153 {ECO:0000244|PDB:2O2O}.
TURN 161 164 {ECO:0000244|PDB:2O2O}.
STRAND 270 276 {ECO:0000244|PDB:2YDL}.
STRAND 283 285 {ECO:0000244|PDB:2K6D}.
STRAND 293 299 {ECO:0000244|PDB:2YDL}.
STRAND 301 303 {ECO:0000244|PDB:2K9G}.
STRAND 306 311 {ECO:0000244|PDB:2YDL}.
STRAND 314 319 {ECO:0000244|PDB:2YDL}.
HELIX 320 322 {ECO:0000244|PDB:2YDL}.
STRAND 323 325 {ECO:0000244|PDB:2YDL}.
HELIX 605 661 {ECO:0000244|PDB:5ABS}.
SEQUENCE 665 AA; 73126 MW; 3BD350FCDB14BD4C CRC64;
MVEAIVEFDY QAQHDDELTI SVGEIITNIR KEDGGWWEGQ INGRRGLFPD NFVREIKKEM
KKDPLTNKAP EKPLHEVPSG NSLLSSETIL RTNKRGERRR RRCQVAFSYL PQNDDELELK
VGDIIEVVGE VEEGWWEGVL NGKTGMFPSN FIKELSGESD ELGISQDEQL SKSSLRETTG
SESDGGDSSS TKSEGANGTV ATAAIQPKKV KGVGFGDIFK DKPIKLRPRS IEVENDFLPV
EKTIGKKLPA TTATPDSSKT EMDSRTKSKD YCKVIFPYEA QNDDELTIKE GDIVTLINKD
CIDVGWWEGE LNGRRGVFPD NFVKLLPPDF EKEGNRPKKP PPPSAPVIKQ GAGTTERKHE
IKKIPPERPE MLPNRTEEKE RPEREPKLDL QKPSVPAIPP KKPRPPKTNS LSRPGALPPR
RPERPVGPLT HTRGDSPKID LAGSSLSGIL DKDLSDRSND IDLEGFDSVV SSTEKLSHPT
TSRPKATGRR PPSQSLTSSS LSSPDIFDSP SPEEDKEEHI SLAHRGVDAS KKTSKTVTIS
QVSDNKASLP PKPGTMAAGG GGPAPLSSAA PSPLSSSLGT AGHRANSPSL FGTEGKPKME
PAASSQAAVE ELRTQVRELR SIIETMKDQQ KREIKQLLSE LDEEKKIRLR LQMEVNDIKK
ALQSK


Related products :

Catalog number Product name Quantity
EIAAB38230 Cbl-interacting protein of 85 kDa,CD2-binding protein 3,CD2BP3,CIN85,Homo sapiens,HSB-1,Human,Human Src family kinase-binding protein 1,SH3 domain-containing kinase-binding protein 1,SH3KBP1
EIAAB41230 Homo sapiens,Human,KIAA0733,MAP3K7IP2,Mitogen-activated protein kinase kinase kinase 7-interacting protein 2,TAB2,TAB-2,TAK1-binding protein 2,TGF-beta-activated kinase 1 and MAP3K7-binding protein 2,
EIAAB31044 Homo sapiens,Human,PICK1,PRKCA-binding protein,PRKCABP,Protein interacting with C kinase 1,Protein kinase C-alpha-binding protein
EIAAB41231 Kiaa0733,Map3k7ip2,Mitogen-activated protein kinase kinase kinase 7-interacting protein 2,Mouse,Mus musculus,Tab2,TAB-2,TAK1-binding protein 2,TGF-beta-activated kinase 1 and MAP3K7-binding protein 2,
EIAAB41233 Kiaa4135,Map3k7ip3,Mitogen-activated protein kinase kinase kinase 7-interacting protein 3,Mouse,Mus musculus,Tab3,TAB-3,TAK1-binding protein 3,TGF-beta-activated kinase 1 and MAP3K7-binding protein 3,
EIAAB41228 Homo sapiens,Human,MAP3K7IP1,Mitogen-activated protein kinase kinase kinase 7-interacting protein 1,TAB1,TAK1-binding protein 1,TGF-beta-activated kinase 1 and MAP3K7-binding protein 1,TGF-beta-activa
EIAAB31041 Pick1,PRKCA-binding protein,Prkcabp,Protein interacting with C kinase 1,Protein kinase C-alpha-binding protein,Rat,Rattus norvegicus
EIAAB31043 Bos taurus,Bovine,PICK1,PRKCA-binding protein,PRKCABP,Protein interacting with C kinase 1,Protein kinase C-alpha-binding protein
EIAAB31042 Mouse,Mus musculus,Pick1,PRKCA-binding protein,Prkcabp,Protein interacting with C kinase 1,Protein kinase C-alpha-binding protein
EIAAB41229 Map3k7ip1,Mitogen-activated protein kinase kinase kinase 7-interacting protein 1,Mouse,Mus musculus,Tab1,TAK1-binding protein 1,TGF-beta-activated kinase 1 and MAP3K7-binding protein 1,TGF-beta-activa
18-661-15208 Mitogen-activated protein kinase kinase kinase 7-interacting protein 1 - TGF-beta-activated kinase 1-binding protein 1; TAK1-binding protein 1 Polyclonal 0.1 mg
EIAAB31325 Casein kinase 2-interacting protein 1,C-Jun-binding protein,CK2-interacting protein 1,CKIP1,CKIP-1,Homo sapiens,HQ0024c,Human,JBP,OC120,Osteoclast maturation-associated gene 120 protein,PH domain-cont
EIAAB41234 Homo sapiens,Human,MAP3K7IP3,Mitogen-activated protein kinase kinase kinase 7-interacting protein 3,NF-kappa-B-activating protein 1,TAB3,TAB-3,TAK1-binding protein 3,TGF-beta-activated kinase 1 and MA
EIAAB04804 AKI1,Akt kinase-interacting protein 1,CC2D1A,Coiled-coil and C2 domain-containing protein 1A,Five repressor element under dual repression-binding protein 1,FRE under dual repression-binding protein 1,
EIAAB41232 Map3k7ip2,Mitogen-activated protein kinase kinase kinase 7-interacting protein 2,Rat,Rattus norvegicus,Tab2,TGF-beta-activated kinase 1 and MAP3K7-binding protein 2,TGF-beta-activated kinase 1-binding
U1394h CLIA Calcium- and integrin-binding protein,Calcium and integrin-binding protein 1,Calmyrin,CIB,CIB,CIB1,CIBP,DNA-PKcs-interacting protein,Homo sapiens,Human,Kinase-interacting protein,KIP,KIP,PRKDCIP, 96T
E1394h ELISA Calcium- and integrin-binding protein,Calcium and integrin-binding protein 1,Calmyrin,CIB,CIB,CIB1,CIBP,DNA-PKcs-interacting protein,Homo sapiens,Human,Kinase-interacting protein,KIP,KIP,PRKDCIP 96T
E1394h ELISA kit Calcium- and integrin-binding protein,Calcium and integrin-binding protein 1,Calmyrin,CIB,CIB,CIB1,CIBP,DNA-PKcs-interacting protein,Homo sapiens,Human,Kinase-interacting protein,KIP,KIP,PR 96T
EIAAB26847 Amyloid beta A4 protein-binding family A member 2-binding protein,APBA2BP,Homo sapiens,Human,NECAB3,Nek2-interacting protein 1,Neuronal calcium-binding protein 3,NIP1,N-terminal EF-hand calcium-bindin
EIAAB12528 CAP-binding protein complex-interacting protein 1,DJ-1-binding protein,DJBP,DJBP,EFCAB6,EF-hand calcium-binding domain-containing protein 6,Homo sapiens,Human,KIAA1672
EIAAB29754 Homo sapiens,HSPC218,Human,PABP-interacting protein 2,PAIP2,PAIP-2,PAIP2A,Poly(A)-binding protein-interacting protein 2,Polyadenylate-binding protein-interacting protein 2
18-003-42203 Mitogen-activated protein kinase kinase kinase 7-interacting protein 2 - TAK1-binding protein 2 Polyclonal 0.05 mg Aff Pur
EIAAB29748 Homo sapiens,Human,KIAA1155,PABP-interacting protein 2B,PAIP2B,PAIP-2B,Poly(A)-binding protein-interacting protein 2B,Polyadenylate-binding protein-interacting protein 2B
18-003-43089 Oligodendrocyte transcription factor 2 - Oligo2; Basic helix-loop-helix protein class B 1; Protein kinase C-binding protein RACK17; Protein kinase C-binding protein 2 Polyclonal 0.05 mg Aff Pur
EIAAB29749 Homo sapiens,Human,PABP-interacting protein 1,PAIP1,PAIP-1,Poly(A)-binding protein-interacting protein 1,Polyadenylate-binding protein-interacting protein 1
Pathways :
WP1616: ABC transporters
WP1531: Vitamin D synthesis
WP731: Sterol regulatory element binding protein related
WP2292: Chemokine signaling pathway
WP1493: Carbon assimilation C4 pathway
WP1909: Signal regulatory protein (SIRP) family interactions
WP1689: Porphyrin and chlorophyll metabolism
WP1371: G Protein Signaling Pathways
WP1693: Purine metabolism
WP2371: Parkinsons Disease Pathway
WP1654: gamma-Hexachlorocyclohexane degradation
WP1661: Glyoxylate and dicarboxylate metabolism
WP2032: TSH signaling pathway
WP346: Protein Modifications
WP1566: Citrate cycle (TCA cycle)
WP1714: Tyrosine metabolism
WP1672: Mismatch repair
WP211: BMP signaling pathway
WP1676: Non-homologous end-joining
WP2218: sGC
WP813: G Protein Signaling Pathways
WP1625: Base excision repair
WP1685: Peptidoglycan biosynthesis
WP232: G Protein Signaling Pathways
WP1165: G Protein Signaling Pathways

Related Genes :
[SH3KBP1 CIN85] SH3 domain-containing kinase-binding protein 1 (CD2-binding protein 3) (CD2BP3) (Cbl-interacting protein of 85 kDa) (Human Src family kinase-binding protein 1) (HSB-1)
[Sh3kbp1 Ruk Seta] SH3 domain-containing kinase-binding protein 1 (Regulator of ubiquitous kinase) (Ruk) (SH3-containing, expressed in tumorigenic astrocytes)
[Sh3kbp1 Ruk Seta] SH3 domain-containing kinase-binding protein 1 (Regulator of ubiquitous kinase) (Ruk) (SH3-containing, expressed in tumorigenic astrocytes)
[CD2AP] CD2-associated protein (Adapter protein CMS) (Cas ligand with multiple SH3 domains)
[CBLB RNF56 Nbla00127] E3 ubiquitin-protein ligase CBL-B (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene b) (RING finger protein 56) (RING-type E3 ubiquitin transferase CBL-B) (SH3-binding protein CBL-B) (Signal transduction protein CBL-B)
[PSTPIP1 CD2BP1] Proline-serine-threonine phosphatase-interacting protein 1 (PEST phosphatase-interacting protein 1) (CD2-binding protein 1) (H-PIP)
[ABI1 SSH3BP1] Abl interactor 1 (Abelson interactor 1) (Abi-1) (Abl-binding protein 4) (AblBP4) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (Nap1-binding protein) (Nap1BP) (Spectrin SH3 domain-binding protein 1) (e3B1)
[NCKIPSD AF3P21 SPIN90] NCK-interacting protein with SH3 domain (54 kDa VacA-interacting protein) (54 kDa vimentin-interacting protein) (VIP54) (90 kDa SH3 protein interacting with Nck) (AF3p21) (Dia-interacting protein 1) (DIP-1) (Diaphanous protein-interacting protein) (SH3 adapter protein SPIN90) (WASP-interacting SH3-domain protein) (WISH) (Wiskott-Aldrich syndrome protein-interacting protein)
[SH3BP1] SH3 domain-binding protein 1
[Cblb] E3 ubiquitin-protein ligase CBL-B (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene b) (RING-type E3 ubiquitin transferase CBL-B) (SH3-binding protein CBL-B) (Signal transduction protein CBL-B)
[UBASH3A STS2] Ubiquitin-associated and SH3 domain-containing protein A (Cbl-interacting protein 4) (CLIP4) (Suppressor of T-cell receptor signaling 2) (STS-2) (T-cell ubiquitin ligand 1) (TULA-1)
[Cblb] E3 ubiquitin-protein ligase CBL-B (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene b) (RING-type E3 ubiquitin transferase CBL-B) (SH3-binding protein CBL-B) (Signal transduction protein CBL-B)
[UBASH3B KIAA1959 STS1] Ubiquitin-associated and SH3 domain-containing protein B (EC 3.1.3.48) (Cbl-interacting protein p70) (Suppressor of T-cell receptor signaling 1) (STS-1) (T-cell ubiquitin ligand 2) (TULA-2) (Tyrosine-protein phosphatase STS1/TULA2)
[KHDRBS1 SAM68] KH domain-containing, RNA-binding, signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68)
[Sh3bp1 3bp1] SH3 domain-binding protein 1 (3BP-1)
[Sh3bp1] SH3 domain-binding protein 1
[GRB2 ASH] Growth factor receptor-bound protein 2 (Adapter protein GRB2) (Protein Ash) (SH2/SH3 adapter GRB2)
[LCK] Tyrosine-protein kinase Lck (EC 2.7.10.2) (Leukocyte C-terminal Src kinase) (LSK) (Lymphocyte cell-specific protein-tyrosine kinase) (Protein YT16) (Proto-oncogene Lck) (T cell-specific protein-tyrosine kinase) (p56-LCK)
[MVB12A CFBP FAM125A] Multivesicular body subunit 12A (CIN85/CD2AP family-binding protein) (ESCRT-I complex subunit MVB12A) (Protein FAM125A)
[SH3PXD2A FISH KIAA0418 SH3MD1 TKS5] SH3 and PX domain-containing protein 2A (Adapter protein TKS5) (Five SH3 domain-containing protein) (SH3 multiple domains protein 1) (Tyrosine kinase substrate with five SH3 domains)
[PIK3R1 GRB1] Phosphatidylinositol 3-kinase regulatory subunit alpha (PI3-kinase regulatory subunit alpha) (PI3K regulatory subunit alpha) (PtdIns-3-kinase regulatory subunit alpha) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha) (PI3-kinase subunit p85-alpha) (PtdIns-3-kinase regulatory subunit p85-alpha)
[SH3GLB1 KIAA0491 CGI-61] Endophilin-B1 (Bax-interacting factor 1) (Bif-1) (SH3 domain-containing GRB2-like protein B1)
[SH3RF2 POSH3 POSHER PPP1R39 RNF158] E3 ubiquitin-protein ligase SH3RF2 (EC 2.3.2.27) (Heart protein phosphatase 1-binding protein) (HEPP1) (POSH-eliminating RING protein) (Protein phosphatase 1 regulatory subunit 39) (RING finger protein 158) (RING-type E3 ubiquitin transferase SH3RF2) (SH3 domain-containing RING finger protein 2)
[SH3BP5 SAB] SH3 domain-binding protein 5 (SH3BP-5) (SH3 domain-binding protein that preferentially associates with BTK)
[RACK1 GNB2L1 HLC7 PIG21] Receptor of activated protein C kinase 1 (Cell proliferation-inducing gene 21 protein) (Guanine nucleotide-binding protein subunit beta-2-like 1) (Guanine nucleotide-binding protein subunit beta-like protein 12.3) (Human lung cancer oncogene 7 protein) (HLC-7) (Receptor for activated C kinase) (Small ribosomal subunit protein RACK1) [Cleaved into: Receptor of activated protein C kinase 1, N-terminally processed (Guanine nucleotide-binding protein subunit beta-2-like 1, N-terminally processed)]
[Abi1 Ssh3bp1] Abl interactor 1 (Abelson interactor 1) (Abi-1) (Ablphilin-1) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (Spectrin SH3 domain-binding protein 1) (e3B1)
[ASAP1 DDEF1 KIAA1249] Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein) (ADP-ribosylation factor-directed GTPase-activating protein 1) (ARF GTPase-activating protein 1) (Development and differentiation-enhancing factor 1) (DEF-1) (Differentiation-enhancing factor 1) (PIP2-dependent ARF1 GAP)
[G3BP1 G3BP] Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1)
[SRC SRC1] Proto-oncogene tyrosine-protein kinase Src (EC 2.7.10.2) (Proto-oncogene c-Src) (pp60c-src) (p60-Src)
[NCK1 NCK] Cytoplasmic protein NCK1 (NCK adaptor protein 1) (Nck-1) (SH2/SH3 adaptor protein NCK-alpha)

Bibliography :
No related Items