GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Serine/arginine-rich splicing factor RS2Z33 (RS-containing zinc finger protein 33) (At-RS2Z33) (At-RSZ33) (AtRSZ33)

 RSZ33_ARATH             Reviewed;         290 AA.
Q8VYA5; F4IQ37; Q67Y02; Q9FYA7; Q9ZUT2;
16-MAY-2012, integrated into UniProtKB/Swiss-Prot.
01-MAR-2002, sequence version 1.
02-JUN-2021, entry version 143.
RecName: Full=Serine/arginine-rich splicing factor RS2Z33;
AltName: Full=RS-containing zinc finger protein 33;
Short=At-RS2Z33;
Short=At-RSZ33;
Short=AtRSZ33;
Name=RS2Z33; Synonyms=RSZ33; OrderedLocusNames=At2g37340; ORFNames=F3G5.13;
Arabidopsis thaliana (Mouse-ear cress).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
NCBI_TaxID=3702;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE
SPECIFICITY, PHOSPHORYLATION, AND INTERACTION WITH SR34; RSZ21; RSZ22;
SCL28; SCL30; SCL33; SCL30A AND SC35.
PubMed=12176998; DOI=10.1074/jbc.m206455200;
Lopato S., Forstner C., Kalyna M., Hilscher J., Langhammer U., Korakod L.,
Zdravko J., Barta A.;
"Network of interactions of a novel plant-specific Arg/Ser-rich protein,
atRSZ33, with atSC35-like splicing factors.";
J. Biol. Chem. 277:39989-39998(2002).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Columbia;
PubMed=10617197; DOI=10.1038/45471;
Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D.,
Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V.,
Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L., Moffat K.S.,
Cronin L.A., Shen M., Pai G., Van Aken S., Umayam L., Tallon L.J.,
Gill J.E., Adams M.D., Carrera A.J., Creasy T.H., Goodman H.M.,
Somerville C.R., Copenhaver G.P., Preuss D., Nierman W.C., White O.,
Eisen J.A., Salzberg S.L., Fraser C.M., Venter J.C.;
"Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.";
Nature 402:761-768(1999).
[3]
GENOME REANNOTATION.
STRAIN=cv. Columbia;
PubMed=27862469; DOI=10.1111/tpj.13415;
Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S.,
Town C.D.;
"Araport11: a complete reannotation of the Arabidopsis thaliana reference
genome.";
Plant J. 89:789-804(2017).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=cv. Columbia;
PubMed=14593172; DOI=10.1126/science.1088305;
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M.,
Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G.,
Liu S.X., Lam B., Sakano H., Wu T., Yu G., Miranda M., Quach H.L.,
Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C.,
Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J.,
Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A.,
Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C.,
Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X.,
Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M.,
Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K.,
Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A.,
Ecker J.R.;
"Empirical analysis of transcriptional activity in the Arabidopsis
genome.";
Science 302:842-846(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
STRAIN=cv. Columbia;
PubMed=14993207; DOI=10.1101/gr.1515604;
Castelli V., Aury J.-M., Jaillon O., Wincker P., Clepet C., Menard M.,
Cruaud C., Quetier F., Scarpelli C., Schaechter V., Temple G., Caboche M.,
Weissenbach J., Salanoubat M.;
"Whole genome sequence comparisons and 'full-length' cDNA sequences: a
combined approach to evaluate and improve Arabidopsis genome annotation.";
Genome Res. 14:406-413(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=cv. Columbia;
Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
Shinozaki K.;
"Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs.";
Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases.
[7]
INTERACTION WITH SR33.
PubMed=10593939; DOI=10.1074/jbc.274.51.36428;
Golovkin M., Reddy A.S.N.;
"An SC35-like protein and a novel serine/arginine-rich protein interact
with Arabidopsis U1-70K protein.";
J. Biol. Chem. 274:36428-36438(1999).
[8]
FUNCTION, ALTERNATIVE SPLICING, AND TISSUE SPECIFICITY.
PubMed=12972547; DOI=10.1091/mbc.e03-02-0109;
Kalyna M., Lopato S., Barta A.;
"Ectopic expression of atRSZ33 reveals its function in splicing and causes
pleiotropic changes in development.";
Mol. Biol. Cell 14:3565-3577(2003).
[9]
SUBCELLULAR LOCATION.
PubMed=15133128; DOI=10.1091/mbc.e04-01-0055;
Lorkovic Z.J., Hilscher J., Barta A.;
"Use of fluorescent protein tags to study nuclear organization of the
spliceosomal machinery in transiently transformed living plant cells.";
Mol. Biol. Cell 15:3233-3243(2004).
[10]
SUBCELLULAR LOCATION.
PubMed=15686520; DOI=10.1111/j.1365-313x.2004.02321.x;
Tillemans V., Dispa L., Remacle C., Collinge M., Motte P.;
"Functional distribution and dynamics of Arabidopsis SR splicing factors in
living plant cells.";
Plant J. 41:567-582(2005).
[11]
INTERACTION WITH SNRNP35.
PubMed=15987817; DOI=10.1261/rna.2440305;
Lorkovic Z.J., Lehner R., Forstner C., Barta A.;
"Evolutionary conservation of minor U12-type spliceosome between plants and
humans.";
RNA 11:1095-1107(2005).
[12]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-202; SER-204; SER-211;
SER-219; SER-226 AND SER-256, AND IDENTIFICATION BY MASS SPECTROMETRY
[LARGE SCALE ANALYSIS].
PubMed=16807317; DOI=10.1093/nar/gkl429;
de la Fuente van Bentem S., Anrather D., Roitinger E., Djamei A.,
Hufnagl T., Barta A., Csaszar E., Dohnal I., Lecourieux D., Hirt H.;
"Phosphoproteomics reveals extensive in vivo phosphorylation of Arabidopsis
proteins involved in RNA metabolism.";
Nucleic Acids Res. 34:3267-3278(2006).
[13]
FUNCTION.
PubMed=16936312; DOI=10.1093/nar/gkl570;
Kalyna M., Lopato S., Voronin V., Barta A.;
"Evolutionary conservation and regulation of particular alternative
splicing events in plant SR proteins.";
Nucleic Acids Res. 34:4395-4405(2006).
[14]
ALTERNATIVE SPLICING.
PubMed=16520337; DOI=10.1093/molbev/msj118;
Iida K., Go M.;
"Survey of conserved alternative splicing events of mRNAs encoding SR
proteins in land plants.";
Mol. Biol. Evol. 23:1085-1094(2006).
[15]
INTERACTION WITH CYP59.
PubMed=16497658; DOI=10.1261/rna.2226106;
Gullerova M., Barta A., Lorkovic Z.J.;
"AtCyp59 is a multidomain cyclophilin from Arabidopsis thaliana that
interacts with SR proteins and the C-terminal domain of the RNA polymerase
II.";
RNA 12:631-643(2006).
[16]
ALTERNATIVE SPLICING, AND INDUCTION.
PubMed=17319848; DOI=10.1111/j.1365-313x.2006.03020.x;
Palusa S.G., Ali G.S., Reddy A.S.;
"Alternative splicing of pre-mRNAs of Arabidopsis serine/arginine-rich
proteins: regulation by hormones and stresses.";
Plant J. 49:1091-1107(2007).
[17]
SUBCELLULAR LOCATION.
PubMed=18674533; DOI=10.1016/j.yexcr.2008.06.020;
Lorkovic Z.J., Hilscher J., Barta A.;
"Co-localisation studies of Arabidopsis SR splicing factors reveal
different types of speckles in plant cell nuclei.";
Exp. Cell Res. 314:3175-3186(2008).
[18]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-211; SER-219 AND SER-256, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
STRAIN=cv. Columbia;
PubMed=19245862; DOI=10.1016/j.jprot.2009.02.004;
Jones A.M.E., MacLean D., Studholme D.J., Serna-Sanz A., Andreasson E.,
Rathjen J.P., Peck S.C.;
"Phosphoproteomic analysis of nuclei-enriched fractions from Arabidopsis
thaliana.";
J. Proteomics 72:439-451(2009).
[19]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-211; SER-219; SER-226;
SER-230; SER-239; SER-245 AND SER-256, AND IDENTIFICATION BY MASS
SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19376835; DOI=10.1104/pp.109.138677;
Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,
Grossmann J., Gruissem W., Baginsky S.;
"Large-scale Arabidopsis phosphoproteome profiling reveals novel
chloroplast kinase substrates and phosphorylation networks.";
Plant Physiol. 150:889-903(2009).
[20]
GENE FAMILY, AND NOMENCLATURE.
PubMed=20884799; DOI=10.1105/tpc.110.078352;
Barta A., Kalyna M., Reddy A.S.;
"Implementing a rational and consistent nomenclature for serine/arginine-
rich protein splicing factors (SR proteins) in plants.";
Plant Cell 22:2926-2929(2010).
[21]
INTERACTION WITH MOS14.
PubMed=21738492; DOI=10.1371/journal.pgen.1002159;
Xu S., Zhang Z., Jing B., Gannon P., Ding J., Xu F., Li X., Zhang Y.;
"Transportin-SR is required for proper splicing of resistance genes and
plant immunity.";
PLoS Genet. 7:E1002159-E1002159(2011).
[22]
GENE FAMILY.
PubMed=21935421; DOI=10.1371/journal.pone.0024542;
Richardson D.N., Rogers M.F., Labadorf A., Ben-Hur A., Guo H.,
Paterson A.H., Reddy A.S.N.;
"Comparative analysis of serine/arginine-rich proteins across 27
eukaryotes: insights into sub-family classification and extent of
alternative splicing.";
PLoS ONE 6:E24542-E24542(2011).
[23]
FUNCTION, AND INTERACTION WITH CDKG1.
PubMed=23404887; DOI=10.1105/tpc.112.107896;
Huang X.Y., Niu J., Sun M.X., Zhu J., Gao J.F., Yang J., Zhou Q.,
Yang Z.N.;
"CYCLIN-DEPENDENT KINASE G1 is associated with the spliceosome to regulate
CALLOSE SYNTHASE5 splicing and pollen wall formation in Arabidopsis.";
Plant Cell 25:637-648(2013).
[24]
INDUCTION.
PubMed=24763593; DOI=10.1126/science.1250322;
Petrillo E., Herz M.A., Fuchs A., Reifer D., Fuller J., Yanovsky M.J.,
Simpson C., Brown J.W., Barta A., Kalyna M., Kornblihtt A.R.;
"A chloroplast retrograde signal regulates nuclear alternative splicing.";
Science 344:427-430(2014).
-!- FUNCTION: Splicing factor involved in constitutive and/or alternative
splicing. Regulates the splicing of its own pre-mRNA and the
alternative splicing of RS30, RS31 and RS34. Associates the cyclin-
dependent kinase G1 (CDKG1) with the spliceosome and recruits it to U1
snRNP to facilitate splicing. {ECO:0000269|PubMed:12972547,
ECO:0000269|PubMed:16936312, ECO:0000269|PubMed:23404887}.
-!- SUBUNIT: Component of the spliceosome. Interacts with SNRNP35, CDKG1,
cyp59, SR33, SR34, RSZ21, RSZ22, SCL28, SCL30, SCL30A, SCL33 and SC35
(PubMed:10593939, PubMed:12176998, PubMed:15987817, PubMed:16497658,
PubMed:23404887). Interacts with MOS14 (PubMed:21738492).
{ECO:0000269|PubMed:10593939, ECO:0000269|PubMed:12176998,
ECO:0000269|PubMed:15987817, ECO:0000269|PubMed:16497658,
ECO:0000269|PubMed:21738492, ECO:0000269|PubMed:23404887}.
-!- SUBCELLULAR LOCATION: Nucleus speckle {ECO:0000269|PubMed:12176998,
ECO:0000269|PubMed:15133128, ECO:0000269|PubMed:15686520,
ECO:0000269|PubMed:18674533}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q8VYA5-1; Sequence=Displayed;
Name=2;
IsoId=Q8VYA5-2; Sequence=VSP_043112;
Name=3;
IsoId=Q8VYA5-3; Sequence=VSP_043113;
-!- TISSUE SPECIFICITY: Expressed in roots, flowers, anthers, pollen,
ovules, style and developing seeds. Not detected in stems or leaves.
{ECO:0000269|PubMed:12176998, ECO:0000269|PubMed:12972547}.
-!- PTM: Extensively phosphorylated on serine residues in the RS domain.
{ECO:0000269|PubMed:12176998}.
-!- MISCELLANEOUS: The splicing pattern of the pre-mRNA is regulated in a
tissue-specific manner and by development, and changes in response to
various types of abiotic stresses (PubMed:17319848), but is not
affected by the light/dark regimes (PubMed:24763593).
{ECO:0000305|PubMed:17319848, ECO:0000305|PubMed:24763593}.
-!- SIMILARITY: Belongs to the splicing factor SR family. RS2Z subfamily.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BX842467; Type=Erroneous termination; Note=Truncated C-terminus.; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AJ293801; CAC03605.1; -; mRNA.
EMBL; AC005896; AAC98054.1; -; Genomic_DNA.
EMBL; CP002685; AEC09385.1; -; Genomic_DNA.
EMBL; CP002685; AEC09386.1; -; Genomic_DNA.
EMBL; CP002685; AEC09387.1; -; Genomic_DNA.
EMBL; CP002685; ANM63217.1; -; Genomic_DNA.
EMBL; CP002685; ANM63218.1; -; Genomic_DNA.
EMBL; CP002685; ANM63219.1; -; Genomic_DNA.
EMBL; AY072315; AAL61922.1; -; mRNA.
EMBL; AY114563; AAM47882.1; -; mRNA.
EMBL; AK176551; BAD44314.1; -; mRNA.
EMBL; BX842463; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; BX842467; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AK176666; BAD44429.1; -; mRNA.
PIR; F84791; F84791.
RefSeq; NP_001325321.1; NM_001336655.1. [Q8VYA5-2]
RefSeq; NP_001325322.1; NM_001336653.1. [Q8VYA5-2]
RefSeq; NP_001325323.1; NM_001336654.1. [Q8VYA5-3]
RefSeq; NP_850280.1; NM_179949.3. [Q8VYA5-1]
RefSeq; NP_973619.1; NM_201890.2. [Q8VYA5-2]
RefSeq; NP_973620.1; NM_201891.2. [Q8VYA5-3]
SMR; Q8VYA5; -.
BioGRID; 3655; 14.
IntAct; Q8VYA5; 11.
STRING; 3702.AT2G37340.1; -.
iPTMnet; Q8VYA5; -.
MetOSite; Q8VYA5; -.
PaxDb; Q8VYA5; -.
PRIDE; Q8VYA5; -.
ProteomicsDB; 226631; -. [Q8VYA5-1]
EnsemblPlants; AT2G37340.1; AT2G37340.1; AT2G37340. [Q8VYA5-1]
EnsemblPlants; AT2G37340.2; AT2G37340.2; AT2G37340. [Q8VYA5-2]
EnsemblPlants; AT2G37340.3; AT2G37340.3; AT2G37340. [Q8VYA5-3]
EnsemblPlants; AT2G37340.4; AT2G37340.4; AT2G37340. [Q8VYA5-2]
EnsemblPlants; AT2G37340.5; AT2G37340.5; AT2G37340. [Q8VYA5-3]
EnsemblPlants; AT2G37340.6; AT2G37340.6; AT2G37340. [Q8VYA5-2]
GeneID; 818311; -.
Gramene; AT2G37340.1; AT2G37340.1; AT2G37340. [Q8VYA5-1]
Gramene; AT2G37340.2; AT2G37340.2; AT2G37340. [Q8VYA5-2]
Gramene; AT2G37340.3; AT2G37340.3; AT2G37340. [Q8VYA5-3]
Gramene; AT2G37340.4; AT2G37340.4; AT2G37340. [Q8VYA5-2]
Gramene; AT2G37340.5; AT2G37340.5; AT2G37340. [Q8VYA5-3]
Gramene; AT2G37340.6; AT2G37340.6; AT2G37340. [Q8VYA5-2]
KEGG; ath:AT2G37340; -.
Araport; AT2G37340; -.
TAIR; locus:2049766; AT2G37340.
eggNOG; KOG0107; Eukaryota.
HOGENOM; CLU_047187_3_0_1; -.
InParanoid; Q8VYA5; -.
OMA; GHIERKC; -.
PhylomeDB; Q8VYA5; -.
PRO; PR:Q8VYA5; -.
Proteomes; UP000006548; Chromosome 2.
ExpressionAtlas; Q8VYA5; baseline and differential.
Genevisible; Q8VYA5; AT.
GO; GO:0016607; C:nuclear speck; IDA:TAIR.
GO; GO:0005681; C:spliceosomal complex; IEA:UniProtKB-KW.
GO; GO:0003729; F:mRNA binding; IDA:TAIR.
GO; GO:0003723; F:RNA binding; IBA:GO_Central.
GO; GO:0008270; F:zinc ion binding; IEA:InterPro.
GO; GO:0000398; P:mRNA splicing, via spliceosome; IBA:GO_Central.
GO; GO:0008380; P:RNA splicing; NAS:TAIR.
GO; GO:0000245; P:spliceosomal complex assembly; TAS:TAIR.
Gene3D; 3.30.70.330; -; 1.
InterPro; IPR012677; Nucleotide-bd_a/b_plait_sf.
InterPro; IPR035979; RBD_domain_sf.
InterPro; IPR000504; RRM_dom.
InterPro; IPR001878; Znf_CCHC.
InterPro; IPR036875; Znf_CCHC_sf.
Pfam; PF00076; RRM_1; 1.
Pfam; PF00098; zf-CCHC; 2.
SMART; SM00360; RRM; 1.
SMART; SM00343; ZnF_C2HC; 2.
SUPFAM; SSF54928; SSF54928; 1.
SUPFAM; SSF57756; SSF57756; 1.
PROSITE; PS50102; RRM; 1.
PROSITE; PS50158; ZF_CCHC; 2.
1: Evidence at protein level;
Alternative splicing; Metal-binding; mRNA processing; mRNA splicing;
Nucleus; Phosphoprotein; Reference proteome; Repeat; Spliceosome; Zinc;
Zinc-finger.
CHAIN 1..290
/note="Serine/arginine-rich splicing factor RS2Z33"
/id="PRO_0000416998"
DOMAIN 11..81
/note="RRM"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"
ZN_FING 99..116
/note="CCHC-type 1"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00047"
ZN_FING 121..138
/note="CCHC-type 2"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00047"
REGION 135..290
/note="Disordered"
/evidence="ECO:0000256|SAM:MobiDB-lite"
COMPBIAS 179..217
/note="Basic and acidic residues"
/evidence="ECO:0000256|SAM:MobiDB-lite"
COMPBIAS 267..282
/note="Basic and acidic residues"
/evidence="ECO:0000256|SAM:MobiDB-lite"
MOD_RES 164
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P92964"
MOD_RES 166
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P92964"
MOD_RES 180
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P92965"
MOD_RES 202
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:16807317"
MOD_RES 204
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:16807317"
MOD_RES 211
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:16807317,
ECO:0007744|PubMed:19245862, ECO:0007744|PubMed:19376835"
MOD_RES 219
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:16807317,
ECO:0007744|PubMed:19245862, ECO:0007744|PubMed:19376835"
MOD_RES 226
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:16807317,
ECO:0007744|PubMed:19376835"
MOD_RES 230
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:19376835"
MOD_RES 239
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:19376835"
MOD_RES 245
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:19376835"
MOD_RES 256
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:16807317,
ECO:0007744|PubMed:19245862, ECO:0007744|PubMed:19376835"
MOD_RES 271
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q9FYB7"
MOD_RES 283
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P92966"
MOD_RES 287
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P92966"
VAR_SEQ 1..49
/note="MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFV ->
MWENTPCMWSLLSSHFRNQ (in isoform 2)"
/evidence="ECO:0000303|PubMed:14993207"
/id="VSP_043112"
VAR_SEQ 1..41
/note="Missing (in isoform 3)"
/evidence="ECO:0000303|PubMed:14993207"
/id="VSP_043113"
CONFLICT 50
/note="E -> V (in Ref. 6; BAD44429)"
/evidence="ECO:0000305"
CONFLICT 139
/note="S -> Q (in Ref. 1; CAC03605)"
/evidence="ECO:0000305"
CONFLICT 173
/note="R -> G (in Ref. 1; CAC03605)"
/evidence="ECO:0000305"
SEQUENCE 290 AA; 32893 MW; 4B0407A7E106EFA2 CRC64;
MPRYDDRYGN TRLYVGRLSS RTRTRDLERL FSRYGRVRDV DMKRDYAFVE FGDPRDADDA
RHYLDGRDFD GSRITVEFSR GAPRGSRDFD SRGPPPGAGR CFNCGVDGHW ARDCTAGDWK
NKCYRCGERG HIERNCKNSP KKLRRSGSYS RSPVRSRSPR RRRSPSRSLS RSRSYSRSRS
PVRRRERSVE ERSRSPKRMD DSLSPRARDR SPVLDDEGSP KIIDGSPPPS PKLQKEVGSD
RDGGSPQDNG RNSVVSPVVG AGGDSSKEDR SPVDDDYEPN RTSPRGSESP


Related products :

Catalog number Product name Quantity
EIAAB39954 40 kDa SR-repressor protein,FUS-interacting serine-arginine-rich protein 1,FUSIP1,FUSIP2,Homo sapiens,Human,Serine_arginine-rich splicing factor 10,SFRS13A,Splicing factor SRp38,Splicing factor, argin
EIAAB38025 Homo sapiens,Human,SCAF,SCAF1,Serine arginine-rich pre-mRNA splicing factor SR-A1,SFRS19,Splicing factor, arginine_serine-rich 19,SRA1,SR-A1,SR-related and CTD-associated factor 1,SR-related-CTD-assoc
PR-774 ASF per SF2 (SFRS1 or SRp30a)His Splicing Factor, Arginine per Serine-rich 1, Pre-mRNA Splicing Factor human, recombinant, E. coli 10
PR-775 ASF per SF2 (SFRS1 or SRp30a)His Splicing Factor, Arginine per Serine-rich 1, Pre-mRNA Splicing Factor human, recombinant, Sf9 insect cells 5
EIAAB39955 Arginine-rich 54 kDa nuclear protein,Homo sapiens,Human,p54,Serine_arginine-rich splicing factor 11,SFRS11,Splicing factor, arginine_serine-rich 11,SRSF11
EIAAB39953 FUS-interacting serine-arginine-rich protein 1,Fusip1,Mouse,Mus musculus,Neural-salient serine_arginine-rich protein,Neural-specific SR protein,Nssr,Serine_arginine-rich splicing factor 10,Sfrs13a,Spl
E1850h Rat ELISA Kit FOR Serine per arginine-rich splicing factor 5 96T
EH1319 Serine per arginine-rich splicing factor 3 Elisa Kit 96T
RPR-352 Recombinant Human Serine arginine-Rich Splicing Factor 1 5
EH1318 Serine per arginine-rich splicing factor 2 Elisa Kit 96T
EH2379 Serine per arginine-rich splicing factor 1 Elisa Kit 96T
CNTLN_HUMAN Mouse ELISA Kit FOR Serine per arginine-rich splicing factor 12 96T
E0321c Mouse ELISA Kit FOR Serine per arginine-rich splicing factor 4 96T
K1737_HUMAN Mouse ELISA Kit FOR Serine per arginine-rich splicing factor 4 96T
PP1G_BOVIN Human ELISA Kit FOR Serine per arginine-rich splicing factor 4 96T
ARNT2_RAT Mouse ELISA Kit FOR Serine per arginine-rich splicing factor 4 96T
E0485h Human ELISA Kit FOR Serine per arginine-rich splicing factor 9 96T
VTA1_MOUSE Mouse ELISA Kit FOR Serine per arginine-rich splicing factor 12 96T
E0056c Mouse ELISA Kit FOR Serine per arginine-rich splicing factor 12 96T
OS9_BOVIN Human ELISA Kit FOR Serine per arginine-rich splicing factor 9 96T
pro-1352 Recombinant Human Serine per arginine-Rich Splicing Factor 1 20
pro-1352 Recombinant Human Serine per arginine-Rich Splicing Factor 1 1mg
H2879 Splicing factor, arginine serine-rich 19 (SCAF1), Rat, ELISA Kit 96T
E0417m Human ELISA Kit FOR Serine per arginine-rich splicing factor 4 96T
RPP14_MOUSE Rabbit ELISA Kit FOR Serine per arginine-rich splicing factor 6 96T
Pathways :
WP2199: Seed Development
WP1659: Glycine, serine and threonine metabolism
WP1983: Splicing factor NOVA regulated synpatic proteins
WP2032: TSH signaling pathway
WP1046: Signaling of Hepatocyte Growth Factor Receptor
WP1689: Porphyrin and chlorophyll metabolism
WP275: Arginine Biosynthesis
WP1625: Base excision repair
WP35: G Protein Signaling Pathways
WP1650: Fluorobenzoate degradation
WP2148: Brain derived neurotrophic factor
WP1165: G Protein Signaling Pathways
WP1693: Purine metabolism
WP1371: G Protein Signaling Pathways
WP1713: Two-component system
WP459: Serine Biosynthesis
WP2185: Purine metabolism
WP1665: Limonene and pinene degradation
WP2218: sGC
WP1502: Mitochondrial biogenesis
WP1888: Post-translational protein modification
WP73: G Protein Signaling Pathways
WP1613: 1,4-Dichlorobenzene degradation
WP1909: Signal regulatory protein (SIRP) family interactions
WP813: G Protein Signaling Pathways

Related Genes :
[RS2Z33 RSZ33 At2g37340 F3G5.13] Serine/arginine-rich splicing factor RS2Z33 (RS-containing zinc finger protein 33) (At-RS2Z33) (At-RSZ33) (AtRSZ33)
[SCL33 SR33 At1g55310 F7A10.15] Serine/arginine-rich SC35-like splicing factor SCL33 (At-SCL33) (AtSCL33) (SC35-like splicing factor 33) (Serine/arginine-rich splicing factor 33)
[RS31 RSP31 At3g61860 F21F14.30] Serine/arginine-rich splicing factor RS31 (At-RSp31) (AtRS31)
[SR30 SRP30 At1g09140 T12M4.19] Serine/arginine-rich splicing factor SR30 (At-SR30) (At-SRp30) (AtSR30) (SF2/ASF-like splicing modulator Srp30) (Serine-arginine rich RNA binding protein 30)
[SR45 RNPS1 At1g16610 F19K19.9] Serine/arginine-rich splicing factor SR45 (At-SR45) (AtSR45) (Serine/arginine-rich ribonucleoprotein 1)
[SRSF1 ASF SF2 SF2P33 SFRS1 OK/SW-cl.3] Serine/arginine-rich splicing factor 1 (Alternative-splicing factor 1) (ASF-1) (Splicing factor, arginine/serine-rich 1) (pre-mRNA-splicing factor SF2, P33 subunit)
[SR45A TRA2 At1g07350 F22G5.31] Serine/arginine-rich splicing factor SR45a (At-SR45A) (AtSR45a) (Protein TRANSFORMER2-like) (atTra2)
[Zrsr1 Sp2 Sp2-7 U2af1-rs1 U2af1l1] U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 1) (SP2) (U2(RNU2) small nuclear RNA auxiliary factor 1-like 1)
[SRSF7 SFRS7] Serine/arginine-rich splicing factor 7 (Splicing factor 9G8) (Splicing factor, arginine/serine-rich 7)
[Srsf1 Sfrs1] Serine/arginine-rich splicing factor 1 (ASF/SF2) (Pre-mRNA-splicing factor SRp30a) (Splicing factor, arginine/serine-rich 1)
[SRSF2 SFRS2] Serine/arginine-rich splicing factor 2 (Protein PR264) (Splicing component, 35 kDa) (Splicing factor SC35) (SC-35) (Splicing factor, arginine/serine-rich 2)
[Srsf7 Sfrs7] Serine/arginine-rich splicing factor 7 (Splicing factor, arginine/serine-rich 7)
[SRSF9 SFRS9 SRP30C] Serine/arginine-rich splicing factor 9 (Pre-mRNA-splicing factor SRp30C) (Splicing factor, arginine/serine-rich 9)
[ZFHX3 ATBF1 C16orf47] Zinc finger homeobox protein 3 (AT motif-binding factor 1) (AT-binding transcription factor 1) (Alpha-fetoprotein enhancer-binding protein) (Zinc finger homeodomain protein 3) (ZFH-3)
[TRA2B SFRS10] Transformer-2 protein homolog beta (TRA-2 beta) (TRA2-beta) (hTRA2-beta) (Splicing factor, arginine/serine-rich 10) (Transformer-2 protein homolog B)
[ARID2 BAF200 KIAA1557] AT-rich interactive domain-containing protein 2 (ARID domain-containing protein 2) (BRG1-associated factor 200) (BAF200) (Zinc finger protein with activation potential) (Zipzap/p200)
[Clasrp Clasp Sfrs16 Srsf16 Swap2] CLK4-associating serine/arginine rich protein (Clk4-associating SR-related protein) (Serine/arginine-rich splicing factor 16) (Splicing factor, arginine/serine-rich 16) (Suppressor of white-apricot homolog 2)
[CLASRP SFRS16 SWAP2 UNQ2428/PRO4988] CLK4-associating serine/arginine rich protein (Splicing factor, arginine/serine-rich 16) (Suppressor of white-apricot homolog 2)
[Tra2b Sfrs10] Transformer-2 protein homolog beta (TRA-2 beta) (TRA2-beta) (RA301) (Splicing factor, arginine/serine-rich 10) (Transformer-2 protein homolog B)
[Arid2 Baf200] AT-rich interactive domain-containing protein 2 (ARID domain-containing protein 2) (BRG1-associated factor 200) (BAF200) (Zinc finger protein with activation potential) (Zipzap/p200)
[Zfhx3 Atbf1] Zinc finger homeobox protein 3 (AT motif-binding factor 1) (AT-binding transcription factor 1) (Alpha-fetoprotein enhancer-binding protein) (Zinc finger homeodomain protein 3) (ZFH-3)
[KMT2A ALL1 CXXC7 HRX HTRX MLL MLL1 TRX1] Histone-lysine N-methyltransferase 2A (Lysine N-methyltransferase 2A) (EC 2.1.1.354) (ALL-1) (CXXC-type zinc finger protein 7) (Cysteine methyltransferase KMT2A) (EC 2.1.1.-) (Myeloid/lymphoid or mixed-lineage leukemia) (Myeloid/lymphoid or mixed-lineage leukemia protein 1) (Trithorax-like protein) (Zinc finger protein HRX) [Cleaved into: MLL cleavage product N320 (N-terminal cleavage product of 320 kDa) (p320); MLL cleavage product C180 (C-terminal cleavage product of 180 kDa) (p180)]
[EGR1 KROX24 ZNF225] Early growth response protein 1 (EGR-1) (AT225) (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24)
[ZNF638 NP220 ZFML] Zinc finger protein 638 (Cutaneous T-cell lymphoma-associated antigen se33-1) (CTCL-associated antigen se33-1) (Nuclear protein 220) (Zinc finger matrin-like protein)
[Tra2b Sfrs10 Silg41] Transformer-2 protein homolog beta (TRA-2 beta) (TRA2-beta) (Silica-induced gene 41 protein) (SIG-41) (Splicing factor, arginine/serine-rich 10) (Transformer-2 protein homolog B)
[ZRANB2 ZIS ZNF265] Zinc finger Ran-binding domain-containing protein 2 (Zinc finger protein 265) (Zinc finger, splicing)
[rsp-6 srp-1 C33H5.12] Probable splicing factor, arginine/serine-rich 6 (CeSRp20) (RNA-binding protein srp-1)
[CPSF30 OXT6 At1g30460 F26G16.5 F26G16.6] 30-kDa cleavage and polyadenylation specificity factor 30 (EC 3.1.21.-) (Protein OXIDATIVE STRESS TOLERANT 6) (Zinc finger CCCH domain-containing protein 11) (AtC3H11)
[EGR2 KROX20] E3 SUMO-protein ligase EGR2 (EC 2.3.2.-) (AT591) (E3 SUMO-protein transferase ERG2) (Early growth response protein 2) (EGR-2) (Zinc finger protein Krox-20)
[ZFP36 G0S24 NUP475 RNF162A TIS11A TTP] mRNA decay activator protein ZFP36 (G0/G1 switch regulatory protein 24) (Growth factor-inducible nuclear protein NUP475) (Tristetraprolin) (Zinc finger protein 36) (Zfp-36)

Bibliography :
No related Items