GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Sodium/calcium exchanger 3 (Na( )/Ca(2 )-exchange protein 3) (Solute carrier family 8 member 3)

 NAC3_HUMAN              Reviewed;         927 AA.
P57103; Q5K3P6; Q5K3P7; Q8IUE9; Q8IUF0; Q8NFI7; Q96QG1; Q96QG2;
01-DEC-2000, integrated into UniProtKB/Swiss-Prot.
29-AUG-2003, sequence version 2.
05-JUN-2019, entry version 155.
RecName: Full=Sodium/calcium exchanger 3;
AltName: Full=Na(+)/Ca(2+)-exchange protein 3;
AltName: Full=Solute carrier family 8 member 3;
Flags: Precursor;
Name=SLC8A3; Synonyms=NCX3;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 2; 3; 4; 7 AND 8).
PubMed=12406570; DOI=10.1016/S0378-1119(02)00982-4;
Gabellini N., Bortoluzzi S., Danieli G.A., Carafoli E.;
"The human SLC8A3 gene and the tissue-specific Na+/Ca2+ exchanger 3
isoforms.";
Gene 298:1-7(2002).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3).
PubMed=12558991; DOI=10.1046/j.1471-4159.2003.01511.x;
Gabellini N., Bortoluzzi S., Danieli G.A., Carafoli E.;
"Control of the Na+/Ca2+ exchanger 3 promoter by cyclic adenosine
monophosphate and Ca2+ in differentiating neurons.";
J. Neurochem. 84:282-293(2003).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 6), AND TISSUE SPECIFICITY.
TISSUE=Brain;
PubMed=15777725; DOI=10.1016/j.gene.2005.01.003;
Lindgren R.M., Zhao J., Heller S., Berglind H., Nister M.;
"Molecular cloning and characterization of two novel truncated
isoforms of human Na+/Ca2+ exchanger 3, expressed in fetal brain.";
Gene 348:143-155(2005).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12508121; DOI=10.1038/nature01348;
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C.,
Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A.,
Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S.,
Sun H., Du H., Pepin K., Artiguenave F., Robert C., Cruaud C.,
Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P.,
Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N.,
Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C.,
Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S.,
Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B.,
Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M.,
Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S.,
Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D.,
Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A.,
Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M.,
Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V.,
Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L.,
Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J.,
Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W.,
Quetier F., Waterston R., Hood L., Weissenbach J.;
"The DNA sequence and analysis of human chromosome 14.";
Nature 421:601-607(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-595.
Kraev A.S., Chumakov I.M., Carafoli E.;
"The organization of the human gene of the sodium-calcium exchanger.";
Submitted (NOV-1995) to the EMBL/GenBank/DDBJ databases.
[8]
FUNCTION, SUBCELLULAR LOCATION, AND DEVELOPMENTAL STAGE.
PubMed=21959935; DOI=10.1038/cdd.2011.125;
Boscia F., D'Avanzo C., Pannaccione A., Secondo A., Casamassa A.,
Formisano L., Guida N., Sokolow S., Herchuelz A., Annunziato L.;
"Silencing or knocking out the Na(+)/Ca(2+) exchanger-3 (NCX3) impairs
oligodendrocyte differentiation.";
Cell Death Differ. 19:562-572(2012).
[9]
REVIEW.
PubMed=23506867; DOI=10.1016/j.mam.2012.07.003;
Khananshvili D.;
"The SLC8 gene family of sodium-calcium exchangers (NCX) - structure,
function, and regulation in health and disease.";
Mol. Aspects Med. 34:220-235(2013).
[10]
VARIANT [LARGE SCALE ANALYSIS] GLN-612.
PubMed=16959974; DOI=10.1126/science.1133427;
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
Vogelstein B., Kinzler K.W., Velculescu V.E.;
"The consensus coding sequences of human breast and colorectal
cancers.";
Science 314:268-274(2006).
-!- FUNCTION: Mediates the electrogenic exchange of Ca(2+) against
Na(+) ions across the cell membrane, and thereby contributes to
the regulation of cytoplasmic Ca(2+) levels and Ca(2+)-dependent
cellular processes. Contributes to cellular Ca(2+) homeostasis in
excitable cells, both in muscle and in brain. In a first phase,
voltage-gated channels mediate the rapid increase of cytoplasmic
Ca(2+) levels due to release of Ca(2+) stores from the endoplasmic
reticulum. SLC8A3 mediates the export of Ca(2+) from the cell
during the next phase, so that cytoplasmic Ca(2+) levels rapidly
return to baseline. Contributes to Ca(2+) transport during
excitation-contraction coupling in muscle. In neurons, contributes
to the rapid decrease of cytoplasmic Ca(2+) levels back to
baseline after neuronal activation, and thereby contributes to
modulate synaptic plasticity, learning and memory (By similarity).
Required for normal oligodendrocyte differentiation and for normal
myelination (PubMed:21959935). Mediates Ca(2+) efflux from
mitochondria and contributes to mitochondrial Ca(2+) ion
homeostasis (By similarity). {ECO:0000250|UniProtKB:S4R2P9,
ECO:0000269|PubMed:21959935}.
-!- ACTIVITY REGULATION: Calcium transport is down-regulated by Na(+)
and stimulated by Ca(2+). {ECO:0000250|UniProtKB:P70549}.
-!- SUBUNIT: Interacts with AKAP1. {ECO:0000250|UniProtKB:S4R2P9}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:21959935};
Multi-pass membrane protein {ECO:0000305}. Perikaryon
{ECO:0000250|UniProtKB:P70549}. Cell projection, dendrite
{ECO:0000250|UniProtKB:P70549}. Cell projection, dendritic spine
{ECO:0000250|UniProtKB:P70549}. Cell membrane, sarcolemma
{ECO:0000250|UniProtKB:S4R2P9}. Cytoplasm, sarcoplasm
{ECO:0000250|UniProtKB:S4R2P9}. Cell junction
{ECO:0000250|UniProtKB:S4R2P9}. Mitochondrion outer membrane
{ECO:0000250|UniProtKB:S4R2P9}; Multi-pass membrane protein
{ECO:0000250|UniProtKB:S4R2P9}. Cytoplasm, perinuclear region
{ECO:0000269|PubMed:21959935}. Endoplasmic reticulum membrane
{ECO:0000305|PubMed:21959935}; Multi-pass membrane protein
{ECO:0000250|UniProtKB:S4R2P9}. Note=Detected at neuromuscular
junctions. {ECO:0000250|UniProtKB:S4R2P9}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=7;
Name=3; Synonyms=NCX3.3;
IsoId=P57103-1; Sequence=Displayed;
Name=2; Synonyms=NCX3.2;
IsoId=P57103-2; Sequence=VSP_008116;
Name=4; Synonyms=NCX3.4;
IsoId=P57103-3; Sequence=VSP_008117, VSP_008118;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay. No
experimental confirmation available.;
Name=5; Synonyms=NCX3-tN.1;
IsoId=P57103-4; Sequence=VSP_043125;
Note=Expressed in fetal brain.;
Name=6; Synonyms=NCX3-tN.2;
IsoId=P57103-5; Sequence=VSP_043126, VSP_008116;
Note=Expressed in fetal brain.;
Name=7;
IsoId=P57103-6; Sequence=VSP_043850;
Name=8;
IsoId=P57103-7; Sequence=VSP_044502;
-!- TISSUE SPECIFICITY: Isoform 2 is expressed in brain and skeletal
muscle. Isoform 3 is expressed in excitable cells of brain, retina
and skeletal muscle. Isoform 4 is expressed in skeletal muscle.
{ECO:0000269|PubMed:15777725}.
-!- DEVELOPMENTAL STAGE: Up-regulated during in vitro differentiation
of oligodendrocytes (at protein level). Up-regulated during in
vitro differentiation of oligodendrocytes.
{ECO:0000269|PubMed:21959935}.
-!- DOMAIN: The cytoplasmic Calx-beta domains bind the regulatory
Ca(2+). The first Calx-beta domain can bind up to four Ca(2+)
ions. The second domain can bind another two Ca(2+) ions that are
essential for calcium-regulated ion exchange.
{ECO:0000250|UniProtKB:P23685}.
-!- SIMILARITY: Belongs to the Ca(2+):cation antiporter (CaCA) (TC
2.A.19) family. SLC8 subfamily. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF510501; AAN60790.1; -; mRNA.
EMBL; AF510502; AAN60791.1; -; mRNA.
EMBL; AF510503; AAN60792.1; -; mRNA.
EMBL; AF508982; AAM90955.1; -; Genomic_DNA.
EMBL; AJ304852; CAC40984.1; -; mRNA.
EMBL; AJ304853; CAC40985.1; -; mRNA.
EMBL; AJ745101; CAG33739.1; -; mRNA.
EMBL; AJ745102; CAG33740.1; -; mRNA.
EMBL; AL135747; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL160191; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471061; EAW81019.1; -; Genomic_DNA.
EMBL; CH471061; EAW81021.1; -; Genomic_DNA.
EMBL; CH471061; EAW81026.1; -; Genomic_DNA.
EMBL; BC142969; AAI42970.1; -; mRNA.
EMBL; X93017; -; NOT_ANNOTATED_CDS; Genomic_DNA.
CCDS; CCDS35498.1; -. [P57103-1]
CCDS; CCDS41967.1; -. [P57103-4]
CCDS; CCDS45131.1; -. [P57103-5]
CCDS; CCDS53904.1; -. [P57103-6]
CCDS; CCDS9799.1; -. [P57103-7]
CCDS; CCDS9800.1; -. [P57103-2]
RefSeq; NP_001123889.1; NM_001130417.2. [P57103-5]
RefSeq; NP_150287.1; NM_033262.4. [P57103-7]
RefSeq; NP_489479.1; NM_058240.3. [P57103-6]
RefSeq; NP_891977.1; NM_182932.2. [P57103-2]
RefSeq; NP_891981.1; NM_182936.2. [P57103-4]
RefSeq; NP_892114.1; NM_183002.2. [P57103-1]
RefSeq; XP_016877095.1; XM_017021606.1. [P57103-1]
RefSeq; XP_016877097.1; XM_017021608.1. [P57103-2]
SMR; P57103; -.
BioGrid; 112437; 8.
IntAct; P57103; 2.
MINT; P57103; -.
STRING; 9606.ENSP00000370669; -.
GuidetoPHARMACOLOGY; 947; -.
TCDB; 2.A.19.3.3; the ca(2+):cation antiporter (caca) family.
iPTMnet; P57103; -.
PhosphoSitePlus; P57103; -.
BioMuta; SLC8A3; -.
DMDM; 34395973; -.
EPD; P57103; -.
PaxDb; P57103; -.
PeptideAtlas; P57103; -.
PRIDE; P57103; -.
ProteomicsDB; 56998; -.
ProteomicsDB; 56999; -. [P57103-2]
ProteomicsDB; 57000; -. [P57103-3]
ProteomicsDB; 57001; -. [P57103-4]
ProteomicsDB; 57002; -. [P57103-5]
ProteomicsDB; 57003; -. [P57103-6]
TopDownProteomics; P57103-2; -. [P57103-2]
DNASU; 6547; -.
Ensembl; ENST00000216568; ENSP00000216568; ENSG00000100678. [P57103-5]
Ensembl; ENST00000356921; ENSP00000349392; ENSG00000100678. [P57103-2]
Ensembl; ENST00000357887; ENSP00000350560; ENSG00000100678. [P57103-7]
Ensembl; ENST00000381269; ENSP00000370669; ENSG00000100678. [P57103-1]
Ensembl; ENST00000394330; ENSP00000377863; ENSG00000100678. [P57103-4]
Ensembl; ENST00000494208; ENSP00000436332; ENSG00000100678. [P57103-3]
Ensembl; ENST00000528359; ENSP00000433531; ENSG00000100678. [P57103-7]
Ensembl; ENST00000534137; ENSP00000436688; ENSG00000100678. [P57103-6]
GeneID; 6547; -.
KEGG; hsa:6547; -.
UCSC; uc001xlu.5; human. [P57103-1]
CTD; 6547; -.
DisGeNET; 6547; -.
GeneCards; SLC8A3; -.
HGNC; HGNC:11070; SLC8A3.
MIM; 607991; gene.
neXtProt; NX_P57103; -.
OpenTargets; ENSG00000100678; -.
PharmGKB; PA315; -.
eggNOG; KOG1306; Eukaryota.
eggNOG; ENOG410XPJP; LUCA.
GeneTree; ENSGT00940000157547; -.
HOGENOM; HOG000266971; -.
InParanoid; P57103; -.
KO; K05849; -.
OMA; SRKEMIR; -.
OrthoDB; 490546at2759; -.
PhylomeDB; P57103; -.
TreeFam; TF314308; -.
Reactome; R-HSA-418359; Reduction of cytosolic Ca++ levels.
Reactome; R-HSA-425561; Sodium/Calcium exchangers.
Reactome; R-HSA-5578775; Ion homeostasis.
Reactome; R-HSA-8949215; Mitochondrial calcium ion transport.
ChiTaRS; SLC8A3; human.
GenomeRNAi; 6547; -.
PRO; PR:P57103; -.
Proteomes; UP000005640; Chromosome 14.
Bgee; ENSG00000100678; Expressed in 113 organ(s), highest expression level in quadriceps femoris.
ExpressionAtlas; P57103; baseline and differential.
Genevisible; P57103; HS.
GO; GO:0030054; C:cell junction; IEA:UniProtKB-SubCell.
GO; GO:0043197; C:dendritic spine; IEA:UniProtKB-SubCell.
GO; GO:0005789; C:endoplasmic reticulum membrane; ISS:UniProtKB.
GO; GO:0005887; C:integral component of plasma membrane; ISS:UniProtKB.
GO; GO:0099055; C:integral component of postsynaptic membrane; IEA:Ensembl.
GO; GO:0031226; C:intrinsic component of plasma membrane; IDA:UniProtKB.
GO; GO:0005874; C:microtubule; IEA:Ensembl.
GO; GO:0005741; C:mitochondrial outer membrane; ISS:UniProtKB.
GO; GO:0031594; C:neuromuscular junction; ISS:UniProtKB.
GO; GO:0043204; C:perikaryon; IEA:UniProtKB-SubCell.
GO; GO:0048471; C:perinuclear region of cytoplasm; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0042383; C:sarcolemma; ISS:UniProtKB.
GO; GO:0016528; C:sarcoplasm; IEA:UniProtKB-SubCell.
GO; GO:0005432; F:calcium:sodium antiporter activity; ISS:UniProtKB.
GO; GO:0005516; F:calmodulin binding; IEA:UniProtKB-KW.
GO; GO:0099580; F:ion antiporter activity involved in regulation of postsynaptic membrane potential; IEA:Ensembl.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:1990034; P:calcium ion export across plasma membrane; IEA:Ensembl.
GO; GO:0098703; P:calcium ion import across plasma membrane; IEA:Ensembl.
GO; GO:0070588; P:calcium ion transmembrane transport; ISS:UniProtKB.
GO; GO:0007154; P:cell communication; IEA:InterPro.
GO; GO:0006874; P:cellular calcium ion homeostasis; ISS:UniProtKB.
GO; GO:0071320; P:cellular response to cAMP; IEA:Ensembl.
GO; GO:0071456; P:cellular response to hypoxia; ISS:UniProtKB.
GO; GO:0002244; P:hematopoietic progenitor cell differentiation; IEA:Ensembl.
GO; GO:0006811; P:ion transport; TAS:Reactome.
GO; GO:0007612; P:learning; ISS:UniProtKB.
GO; GO:0060291; P:long-term synaptic potentiation; ISS:UniProtKB.
GO; GO:0007613; P:memory; ISS:UniProtKB.
GO; GO:0051560; P:mitochondrial calcium ion homeostasis; ISS:UniProtKB.
GO; GO:0006851; P:mitochondrial calcium ion transmembrane transport; ISS:UniProtKB.
GO; GO:0042552; P:myelination; ISS:UniProtKB.
GO; GO:0048709; P:oligodendrocyte differentiation; ISS:UniProtKB.
GO; GO:1903779; P:regulation of cardiac conduction; TAS:Reactome.
GO; GO:0014819; P:regulation of skeletal muscle contraction; ISS:UniProtKB.
GO; GO:0035725; P:sodium ion transmembrane transport; ISS:UniProtKB.
GO; GO:0021537; P:telencephalon development; IEA:Ensembl.
Gene3D; 2.60.40.2030; -; 2.
InterPro; IPR038081; CalX-like_sf.
InterPro; IPR003644; Calx_beta.
InterPro; IPR004836; Na_Ca_Ex.
InterPro; IPR032452; Na_Ca_Ex_C-exten.
InterPro; IPR004837; NaCa_Exmemb.
Pfam; PF03160; Calx-beta; 2.
Pfam; PF01699; Na_Ca_ex; 2.
Pfam; PF16494; Na_Ca_ex_C; 1.
PRINTS; PR01259; NACAEXCHNGR.
SMART; SM00237; Calx_beta; 2.
SUPFAM; SSF141072; SSF141072; 2.
TIGRFAMs; TIGR00845; caca; 1.
1: Evidence at protein level;
Alternative splicing; Antiport; Calcium; Calcium transport;
Calmodulin-binding; Cell junction; Cell membrane; Cell projection;
Complete proteome; Cytoplasm; Endoplasmic reticulum; Glycoprotein;
Ion transport; Membrane; Metal-binding; Mitochondrion;
Mitochondrion outer membrane; Polymorphism; Reference proteome;
Repeat; Signal; Sodium; Sodium transport; Transmembrane;
Transmembrane helix; Transport.
SIGNAL 1 30 {ECO:0000255}.
CHAIN 31 927 Sodium/calcium exchanger 3.
/FTId=PRO_0000019384.
TOPO_DOM 31 73 Extracellular. {ECO:0000255}.
TRANSMEM 74 94 Helical. {ECO:0000255}.
TOPO_DOM 95 147 Cytoplasmic. {ECO:0000255}.
TRANSMEM 148 168 Helical. {ECO:0000255}.
TOPO_DOM 169 169 Extracellular. {ECO:0000255}.
TRANSMEM 170 190 Helical. {ECO:0000255}.
TOPO_DOM 191 202 Cytoplasmic. {ECO:0000255}.
TRANSMEM 203 223 Helical. {ECO:0000255}.
TOPO_DOM 224 230 Extracellular. {ECO:0000255}.
TRANSMEM 231 251 Helical. {ECO:0000255}.
TOPO_DOM 252 726 Cytoplasmic. {ECO:0000255}.
TRANSMEM 727 747 Helical. {ECO:0000255}.
TOPO_DOM 748 754 Extracellular. {ECO:0000255}.
TRANSMEM 755 775 Helical. {ECO:0000255}.
TOPO_DOM 776 778 Cytoplasmic. {ECO:0000255}.
TRANSMEM 779 799 Helical. {ECO:0000255}.
TOPO_DOM 800 828 Extracellular. {ECO:0000255}.
TRANSMEM 829 849 Helical. {ECO:0000255}.
TOPO_DOM 850 860 Cytoplasmic. {ECO:0000255}.
TRANSMEM 861 881 Helical. {ECO:0000255}.
TOPO_DOM 882 903 Extracellular. {ECO:0000255}.
TRANSMEM 904 924 Helical. {ECO:0000255}.
TOPO_DOM 925 927 Cytoplasmic. {ECO:0000255}.
REPEAT 140 180 Alpha-1.
DOMAIN 386 485 Calx-beta 1.
DOMAIN 519 619 Calx-beta 2.
REPEAT 796 832 Alpha-2.
REGION 253 272 Putative calmodulin-binding region.
{ECO:0000250|UniProtKB:P23685}.
METAL 409 409 Calcium 1.
{ECO:0000250|UniProtKB:P23685}.
METAL 409 409 Calcium 2.
{ECO:0000250|UniProtKB:P23685}.
METAL 409 409 Calcium 3.
{ECO:0000250|UniProtKB:P23685}.
METAL 445 445 Calcium 1.
{ECO:0000250|UniProtKB:P23685}.
METAL 445 445 Calcium 4.
{ECO:0000250|UniProtKB:P23685}.
METAL 470 470 Calcium 2.
{ECO:0000250|UniProtKB:P23685}.
METAL 471 471 Calcium 1.
{ECO:0000250|UniProtKB:P23685}.
METAL 471 471 Calcium 2; via carbonyl oxygen.
{ECO:0000250|UniProtKB:P23685}.
METAL 471 471 Calcium 3.
{ECO:0000250|UniProtKB:P23685}.
METAL 471 471 Calcium 4.
{ECO:0000250|UniProtKB:P23685}.
METAL 473 473 Calcium 3; via carbonyl oxygen.
{ECO:0000250|UniProtKB:P23685}.
METAL 475 475 Calcium 1.
{ECO:0000250|UniProtKB:P23685}.
METAL 475 475 Calcium 3.
{ECO:0000250|UniProtKB:P23685}.
METAL 475 475 Calcium 4.
{ECO:0000250|UniProtKB:P23685}.
METAL 478 478 Calcium 4.
{ECO:0000250|UniProtKB:P23685}.
METAL 525 525 Calcium 3.
{ECO:0000250|UniProtKB:P23685}.
METAL 526 526 Calcium 2.
{ECO:0000250|UniProtKB:P23685}.
METAL 527 527 Calcium 2.
{ECO:0000250|UniProtKB:P23685}.
METAL 527 527 Calcium 3.
{ECO:0000250|UniProtKB:P23685}.
METAL 543 543 Calcium 5.
{ECO:0000250|UniProtKB:P23685}.
METAL 579 579 Calcium 6.
{ECO:0000250|UniProtKB:P23685}.
METAL 606 606 Calcium 6.
{ECO:0000250|UniProtKB:P23685}.
METAL 607 607 Calcium 5; via carbonyl oxygen.
{ECO:0000250|UniProtKB:P23685}.
METAL 607 607 Calcium 6.
{ECO:0000250|UniProtKB:P23685}.
METAL 672 672 Calcium 5.
{ECO:0000250|UniProtKB:P23685}.
CARBOHYD 45 45 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 823 823 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 643 Missing (in isoform 5).
{ECO:0000303|PubMed:15777725}.
/FTId=VSP_043125.
VAR_SEQ 1 623 Missing (in isoform 6).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:15777725}.
/FTId=VSP_043126.
VAR_SEQ 596 620 KTIRVKIVDEEEYERQENFFIALGE -> CDRQEADYGRRG
GQEDSRDGKASIG (in isoform 4).
{ECO:0000303|PubMed:12406570}.
/FTId=VSP_008117.
VAR_SEQ 599 638 RVKIVDEEEYERQENFFIALGEPKWMERGISALLLSPDVT
-> HIKVIDDEAYEKNKNYFIEMMGPRMVDMSFQKALLLSP
(in isoform 8).
{ECO:0000303|PubMed:12406570}.
/FTId=VSP_044502.
VAR_SEQ 621 927 Missing (in isoform 4).
{ECO:0000303|PubMed:12406570}.
/FTId=VSP_008118.
VAR_SEQ 630 635 Missing (in isoform 2 and isoform 6).
{ECO:0000303|PubMed:12406570,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:15777725}.
/FTId=VSP_008116.
VAR_SEQ 636 638 Missing (in isoform 7).
{ECO:0000303|PubMed:12406570}.
/FTId=VSP_043850.
VARIANT 612 612 E -> Q (in a breast cancer sample;
somatic mutation).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036463.
SEQUENCE 927 AA; 103010 MW; 7B43CB6A9D77615E CRC64;
MAWLRLQPLT SAFLHFGLVT FVLFLNGLRA EAGGSGDVPS TGQNNESCSG SSDCKEGVIL
PIWYPENPSL GDKIARVIVY FVALIYMFLG VSIIADRFMA SIEVITSQER EVTIKKPNGE
TSTTTIRVWN ETVSNLTLMA LGSSAPEILL SLIEVCGHGF IAGDLGPSTI VGSAAFNMFI
IIGICVYVIP DGETRKIKHL RVFFITAAWS IFAYIWLYMI LAVFSPGVVQ VWEGLLTLFF
FPVCVLLAWV ADKRLLFYKY MHKKYRTDKH RGIIIETEGD HPKGIEMDGK MMNSHFLDGN
LVPLEGKEVD ESRREMIRIL KDLKQKHPEK DLDQLVEMAN YYALSHQQKS RAFYRIQATR
MMTGAGNILK KHAAEQAKKA SSMSEVHTDE PEDFISKVFF DPCSYQCLEN CGAVLLTVVR
KGGDMSKTMY VDYKTEDGSA NAGADYEFTE GTVVLKPGET QKEFSVGIID DDIFEEDEHF
FVRLSNVRIE EEQPEEGMPP AIFNSLPLPR AVLASPCVAT VTILDDDHAG IFTFECDTIH
VSESIGVMEV KVLRTSGARG TVIVPFRTVE GTAKGGGEDF EDTYGELEFK NDETVKTIRV
KIVDEEEYER QENFFIALGE PKWMERGISA LLLSPDVTDR KLTMEEEEAK RIAEMGKPVL
GEHPKLEVII EESYEFKTTV DKLIKKTNLA LVVGTHSWRD QFMEAITVSA AGDEDEDESG
EERLPSCFDY VMHFLTVFWK VLFACVPPTE YCHGWACFAV SILIIGMLTA IIGDLASHFG
CTIGLKDSVT AVVFVAFGTS VPDTFASKAA ALQDVYADAS IGNVTGSNAV NVFLGIGLAW
SVAAIYWALQ GQEFHVSAGT LAFSVTLFTI FAFVCISVLL YRRRPHLGGE LGGPRGCKLA
TTWLFVSLWL LYILFATLEA YCYIKGF


Related products :

Catalog number Product name Quantity
E12412078 Rat Solute Carrier Family 8 (Sodium per calcium Exchanger), Member 1 (SLC8A1)ELISA Kit 1
EIAAB26540 Homo sapiens,Human,Na(+)_K(+)_Ca(2+)-exchange protein 2,NCKX2,Retinal cone Na-Ca+K exchanger,SLC24A2,Sodium_potassium_calcium exchanger 2,Solute carrier family 24 member 2
E1380130 Guinea pig Solute Carrier Family 8 (Sodium per calcium Exchanger), Member 1 (SLC8A1) ELISA Kit
E13832950 Chicken Solute Carrier Family 8 (Sodium per calcium Exchanger), Member 1 (SLC8A1)ELISA Kit
EIAAB26550 Mouse,Mus musculus,Na(+)_K(+)_Ca(2+)-exchange protein 6,Nckx6,Slc24a6,Sodium_potassium_calcium exchanger 6,Solute carrier family 24 member 6
EIAAB26548 Mouse,Mus musculus,Na(+)_K(+)_Ca(2+)-exchange protein 5,Nckx5,Slc24a5,Sodium_potassium_calcium exchanger 5,Solute carrier family 24 member 5
EIAAB26546 Homo sapiens,Human,Na(+)_K(+)_Ca(2+)-exchange protein 4,NCKX4,SLC24A4,Sodium_potassium_calcium exchanger 4,Solute carrier family 24 member 4
EIAAB26544 Homo sapiens,Human,Na(+)_K(+)_Ca(2+)-exchange protein 3,NCKX3,SLC24A3,Sodium_potassium_calcium exchanger 3,Solute carrier family 24 member 3
EIAAB26552 Na(+)_K(+)_Ca(2+)-exchange protein 6,Nckx6,Nclx,Rat,Rattus norvegicus,Slc24a6,Sodium_potassium_calcium exchanger 6,Solute carrier family 24 member 6
EIAAB26549 Homo sapiens,Human,JSX,Na(+)_K(+)_Ca(2+)-exchange protein 5,NCKX5,SLC24A5,Sodium_potassium_calcium exchanger 5,Solute carrier family 24 member 5
EIAAB26551 Homo sapiens,Human,Na(+)_K(+)_Ca(2+)-exchange protein 6,NCKX6,NCLX,SLC24A6,Sodium_potassium_calcium exchanger 6,Solute carrier family 24 member 6
EIAAB27170 Na(+)_H(+) exchange regulatory cofactor NHE-RF2,NHERF2,Oryctolagus cuniculus,PDZ domain-containing protein NHERF-2,Rabbit,SLC9A3R2,Sodium-hydrogen exchanger regulatory factor 2,Solute carrier family 9
EIAAB37103 Electroneutral Na+-driven Cl-HCO3 exchanger,Electroneutral sodium bicarbonate exchanger 1,k-NBC3,Ndcbe1,Rat,Rattus norvegicus,Slc4a8,Solute carrier family 4 member 8
EIAAB37102 Electroneutral Na+-driven Cl-HCO3 exchanger,Electroneutral sodium bicarbonate exchanger 1,Kiaa0739,k-NBC3,Mouse,Mus musculus,Slc4a8,Solute carrier family 4 member 8
GWB-FEFC12 Anti- SLC9A9 (solute carrier family 9 (sodium hydrogen exchanger). member 9) Antibody
EIAAB37165 Gm610,Mouse,Mus musculus,Na(+)_H(+) exchanger 10,NHE-10,Slc9a10,sNHE,Sodium_hydrogen exchanger 10,Solute carrier family 10 member 10,Sperm-specific Na(+)_H(+) exchanger
EIAAB37166 Homo sapiens,Human,Na(+)_H(+) exchanger 10,NHE-10,SLC9A10,sNHE,Sodium_hydrogen exchanger 10,Solute carrier family 9 member 10,Sperm-specific Na(+)_H(+) exchanger
EIAAB37088 Bos taurus,Bovine,SLC4A10,Sodium-driven chloride bicarbonate exchanger,Solute carrier family 4 member 10
EIAAB37086 Ncbe,Rat,Rattus norvegicus,Slc4a10,Sodium-driven chloride bicarbonate exchanger,Solute carrier family 4 member 10
EIAAB37104 Electroneutral Na(+)-driven Cl-HCO3 exchanger,Electroneutral sodium bicarbonate exchanger 1,Homo sapiens,Human,KIAA0739,k-NBC3,NBC,NBC3,NDCBE1,SLC4A8,Solute carrier family 4 member 8
GWB-C757EC Solute Carrier Family 9 (Sodium Hydrogen Exchanger) Member 3 Regulator 1 (SLC9A3R1) Mouse anti-Human Monoclonal (EBP-10) Antibo
GWB-AED125 Solute Carrier Family 9 (Sodium Hydrogen Exchanger) Member 9 (SLC9A9) Rabbit anti-Mouse Polyclonal (C-Terminus) Antibody
EIAAB37085 Homo sapiens,Human,NCBE,SLC4A10,Sodium-driven chloride bicarbonate exchanger,Solute carrier family 4 member 10
EIAAB37087 Kiaa4136,Mouse,Mus musculus,Ncbe,Slc4a10,Sodium-driven chloride bicarbonate exchanger,Solute carrier family 4 member 10
EIAAB38595 Na(+)_H(+) exchanger 1,NHE1,NHE-1,Pig,SLC9A1,Sodium_hydrogen exchanger 1,Solute carrier family 9 member 1,Sus scrofa
Pathways :
WP1502: Mitochondrial biogenesis
WP1909: Signal regulatory protein (SIRP) family interactions
WP2199: Seed Development
WP211: BMP signaling pathway
WP1165: G Protein Signaling Pathways
WP1700: Selenoamino acid metabolism
WP813: G Protein Signaling Pathways
WP1657: Glycerolipid metabolism
WP2218: sGC
WP1663: Homologous recombination
WP232: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1780: ABC-family proteins mediated transport
WP1834: Interactions of the immunoglobulin superfamily (IgSF) member proteins
WP1673: Naphthalene and anthracene degradation
WP2371: Parkinsons Disease Pathway
WP1678: Nucleotide excision repair
WP35: G Protein Signaling Pathways
WP1613: 1,4-Dichlorobenzene degradation
WP1625: Base excision repair
WP210: Cytoplasmic Ribosomal Proteins
WP1690: Propanoate metabolism
WP553: Calcium Regulation in the Cardiac Cell
WP1159: Calcium Regulation in the Cardiac Cell
WP1694: Pyrimidine metabolism

Related Genes :
[Slc8b1 Nckx6 Nclx Slc24a6] Mitochondrial sodium/calcium exchanger protein (Na(+)/K(+)/Ca(2+)-exchange protein 6) (Sodium/calcium exchanger protein, mitochondrial) (Sodium/potassium/calcium exchanger 6) (Solute carrier family 24 member 6) (Solute carrier family 8 member B1)
[Slc8b1 Nckx6 Nclx Slc24a6] Mitochondrial sodium/calcium exchanger protein (Na(+)/K(+)/Ca(2+)-exchange protein 6) (Sodium/calcium exchanger protein, mitochondrial) (Sodium/potassium/calcium exchanger 6) (Solute carrier family 24 member 6) (Solute carrier family 8 member B1)
[SLC8B1 NCKX6 NCLX SLC24A6] Mitochondrial sodium/calcium exchanger protein (Na(+)/K(+)/Ca(2+)-exchange protein 6) (Sodium/calcium exchanger protein, mitochondrial) (Sodium/potassium/calcium exchanger 6) (Solute carrier family 24 member 6) (Solute carrier family 8 member B1)
[Slc8a3 Ncx3] Sodium/calcium exchanger 3 (Na(+)/Ca(2+)-exchange protein 3) (Solute carrier family 8 member 3)
[SLC8A3 NCX3] Sodium/calcium exchanger 3 (Na(+)/Ca(2+)-exchange protein 3) (Solute carrier family 8 member 3)
[Slc8a3 Ncx3] Sodium/calcium exchanger 3 (Na(+)/Ca(2+)-exchange protein 3) (Solute carrier family 8 member 3)
[Slc8a1 Ncx1] Sodium/calcium exchanger 1 (Na(+)/Ca(2+)-exchange protein 1) (Solute carrier family 8 member 1)
[SLC24A5 JSX NCKX5] Sodium/potassium/calcium exchanger 5 (Na(+)/K(+)/Ca(2+)-exchange protein 5) (Solute carrier family 24 member 5)
[SLC24A4 NCKX4] Sodium/potassium/calcium exchanger 4 (Na(+)/K(+)/Ca(2+)-exchange protein 4) (Solute carrier family 24 member 4)
[SLC24A1 KIAA0702 NCKX1] Sodium/potassium/calcium exchanger 1 (Na(+)/K(+)/Ca(2+)-exchange protein 1) (Retinal rod Na-Ca+K exchanger) (Solute carrier family 24 member 1)
[Slc24a4 Nckx4] Sodium/potassium/calcium exchanger 4 (Na(+)/K(+)/Ca(2+)-exchange protein 4) (Solute carrier family 24 member 4)
[SLC9A3 NHE3] Sodium/hydrogen exchanger 3 (Na(+)/H(+) exchanger 3) (NHE-3) (Solute carrier family 9 member 3)
[SLC25A23 APC2 MCSC2 SCAMC3] Calcium-binding mitochondrial carrier protein SCaMC-3 (Mitochondrial ATP-Mg/Pi carrier protein 2) (Mitochondrial Ca(2+)-dependent solute carrier protein 2) (Small calcium-binding mitochondrial carrier protein 3) (Solute carrier family 25 member 23)
[Slc9a3 Nhe3] Sodium/hydrogen exchanger 3 (Na(+)/H(+) exchanger 3) (NHE-3) (Solute carrier family 9 member 3)
[SLC25A25 APC3 KIAA1896 MCSC3 SCAMC2 UNQ549/PRO1106] Calcium-binding mitochondrial carrier protein SCaMC-2 (Mitochondrial ATP-Mg/Pi carrier protein 3) (Mitochondrial Ca(2+)-dependent solute carrier protein 3) (Small calcium-binding mitochondrial carrier protein 2) (Solute carrier family 25 member 25)
[SLC9A3 NHE3] Sodium/hydrogen exchanger 3 (Na(+)/H(+) exchanger 3) (NHE-3) (Solute carrier family 9 member 3)
[SLC9A3R1 NHERF NHERF1] Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF-1) (Ezrin-radixin-moesin-binding phosphoprotein 50) (EBP50) (Regulatory cofactor of Na(+)/H(+) exchanger) (Sodium-hydrogen exchanger regulatory factor 1) (Solute carrier family 9 isoform A3 regulatory factor 1)
[SLC9A1 APNH1 NHE1] Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter, amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)
[SLC9B2 NHA2 NHEDC2] Sodium/hydrogen exchanger 9B2 (Na(+)/H(+) exchanger NHA2) (Na(+)/H(+) exchanger-like domain-containing protein 2) (NHE domain-containing protein 2) (Sodium/hydrogen exchanger-like domain-containing protein 2) (Solute carrier family 9 subfamily B member 2)
[Slc9b2 Nha2 Nhedc2] Sodium/hydrogen exchanger 9B2 (NHA-oc) (Na(+)/H(+) exchanger NHA2) (Na(+)/H(+) exchanger-like domain-containing protein 2) (NHE domain-containing protein 2) (Soditlum/hydrogen exchanger-like domain-containing protein 2) (Solute carrier family 9 subfamily B member 2)
[NCL At1g53210 F12M16.12] Sodium/calcium exchanger NCL (Na(+)/Ca(2+)-exchange protein NCL) (Protein NCX-like) (AtNCL)
[SLC4A1 AE1 DI EPB3] Band 3 anion transport protein (Anion exchange protein 1) (AE 1) (Anion exchanger 1) (Solute carrier family 4 member 1) (CD antigen CD233)
[slc24a5 nckx5] Sodium/potassium/calcium exchanger 5 (Na(+)/K(+)/Ca(2+)-exchange protein 5) (Protein golden) (Solute carrier family 24 member 5)
[SLC9A9 NHE9 Nbla00118] Sodium/hydrogen exchanger 9 (Na(+)/H(+) exchanger 9) (NHE-9) (Solute carrier family 9 member 9)
[Slc9a1 Nhe1] Sodium/hydrogen exchanger 1 (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)
[Slc9b1 Nha1 Nhedc1] Sodium/hydrogen exchanger 9B1 (Na(+)/H(+) exchanger-like domain-containing protein 1) (NHE domain-containing protein 1) (Sodium/hydrogen exchanger-like domain-containing protein 1) (Solute carrier family 9 subfamily B member 1) (Testis specific sodium-hydrogen exchanger) (MtsNHE)
[SLC9A3R1 NHERF NHERF1 QtsA-18078] Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF-1) (Ezrin-radixin-moesin-binding phosphoprotein 50) (EBP50) (Regulatory cofactor of Na(+)/H(+) exchanger) (Sodium-hydrogen exchanger regulatory factor 1) (Solute carrier family 9 isoform A3 regulatory factor 1)
[Slc9a1 Nhe1] Sodium/hydrogen exchanger 1 (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)
[SLC9A1 NHE1] Sodium/hydrogen exchanger 1 (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)
[SLC9A1 NHE1] Sodium/hydrogen exchanger 1 (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)

Bibliography :