GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Solute carrier family 2, facilitated glucose transporter member 4 (Glucose transporter type 4, insulin-responsive) (GLUT-4)

 GLUT4_HUMAN             Reviewed;         509 AA.
P14672; Q05BQ3; Q14CX2;
01-APR-1990, integrated into UniProtKB/Swiss-Prot.
01-APR-1990, sequence version 1.
13-FEB-2019, entry version 215.
RecName: Full=Solute carrier family 2, facilitated glucose transporter member 4 {ECO:0000305};
AltName: Full=Glucose transporter type 4, insulin-responsive;
Short=GLUT-4;
Name=SLC2A4 {ECO:0000312|HGNC:HGNC:11009}; Synonyms=GLUT4;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=2656669;
Fukumoto H., Kayano T., Buse J.B., Edwards Y., Pilch P.F., Bell G.I.,
Seino S.;
"Cloning and characterization of the major insulin-responsive glucose
transporter expressed in human skeletal muscle and other insulin-
responsive tissues.";
J. Biol. Chem. 264:7776-7779(1989).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANT THR-385.
PubMed=1397719; DOI=10.2337/diab.41.11.1436;
Buse J.B., Yasuda K., Lay T.P., Seo T.S., Olson A.L., Pessin J.E.,
Karam J.H., Seino S., Bell G.I.;
"Human GLUT4/muscle-fat glucose-transporter gene. Characterization and
genetic variation.";
Diabetes 41:1436-1445(1992).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16625196; DOI=10.1038/nature04689;
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R.,
Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A.,
Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J.,
Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J.,
DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R.,
Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N.,
Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B.,
Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J.,
Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E.,
Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J.,
Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C.,
Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D.,
Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A.,
Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.;
"DNA sequence of human chromosome 17 and analysis of rearrangement in
the human lineage.";
Nature 440:1045-1049(2006).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Colon;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-11.
PubMed=7916714; DOI=10.1016/0378-1119(93)90438-9;
Chiaramonte R., Martini R., Taramelli R., Comi P.;
"Identification of the 5' end of the gene encoding a human insulin-
responsive glucose transporter.";
Gene 130:307-308(1993).
[6]
SUBCELLULAR LOCATION, AND MUTAGENESIS OF 489-LEU-LEU-490.
PubMed=8300557;
Verhey K.J., Birnbaum M.J.;
"A Leu-Leu sequence is essential for COOH-terminal targeting signal of
GLUT4 glucose transporter in fibroblasts.";
J. Biol. Chem. 269:2353-2356(1994).
[7]
INTERACTION WITH DAXX, AND SUMOYLATION.
PubMed=11842083; DOI=10.1074/jbc.M110294200;
Lalioti V.S., Vergarajauregui S., Pulido D., Sandoval I.V.;
"The insulin-sensitive glucose transporter, GLUT4, interacts
physically with Daxx. Two proteins with capacity to bind Ubc9 and
conjugated to SUMO1.";
J. Biol. Chem. 277:19783-19791(2002).
[8]
INTERACTION WITH SRFBP1.
PubMed=16647043; DOI=10.1016/j.bbrc.2006.04.017;
Lisinski I., Matsumoto H., Yver D.R., Schuermann A., Cushman S.W.,
Al-Hasani H.;
"Identification and characterization of p49/STRAP as a novel GLUT4-
binding protein.";
Biochem. Biophys. Res. Commun. 344:1179-1185(2006).
[9]
PHOSPHORYLATION AT SER-274 BY SGK1.
PubMed=17382906; DOI=10.1016/j.bbrc.2007.03.029;
Jeyaraj S., Boehmer C., Lang F., Palmada M.;
"Role of SGK1 kinase in regulating glucose transport via glucose
transporter GLUT4.";
Biochem. Biophys. Res. Commun. 356:629-635(2007).
[10]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[11]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-57.
TISSUE=Leukemic T-cell;
PubMed=19349973; DOI=10.1038/nbt.1532;
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M.,
Schiess R., Aebersold R., Watts J.D.;
"Mass-spectrometric identification and relative quantification of N-
linked cell surface glycoproteins.";
Nat. Biotechnol. 27:378-386(2009).
[12]
VARIANT NIDDM ILE-383.
PubMed=1918382; DOI=10.1172/JCI115437;
Kusari J., Verma U.S., Buse J.B., Henry R.R., Olefsky J.M.;
"Analysis of the gene sequences of the insulin receptor and the
insulin-sensitive glucose transporter (GLUT-4) in patients with
common-type non-insulin-dependent diabetes mellitus.";
J. Clin. Invest. 88:1323-1330(1991).
[13]
VARIANT NIDDM ILE-383.
PubMed=1756912; DOI=10.2337/diab.40.12.1712;
Choi W.H., O'Rahilly S., Buse J.B., Rees A., Morgan R., Flier J.S.,
Moller D.E.;
"Molecular scanning of insulin-responsive glucose transporter (GLUT4)
gene in NIDDM subjects.";
Diabetes 40:1712-1718(1991).
[14]
VARIANT NIDDM ILE-383.
PubMed=1521731; DOI=10.1007/BF02342449;
O'Rahilly S., Krook A., Morgan R., Rees A., Flier J.S., Moller D.E.;
"Insulin receptor and insulin-responsive glucose transporter (GLUT 4)
mutations and polymorphisms in a Welsh type 2 (non-insulin-dependent)
diabetic population.";
Diabetologia 35:486-489(1992).
-!- FUNCTION: Insulin-regulated facilitative glucose transporter.
-!- SUBUNIT: Interacts with NDUFA9 (By similarity). Binds to DAXX
(PubMed:11842083). Interacts via its N-terminus with SRFBP1
(PubMed:16647043). Interacts with TRARG1; the interaction is
required for proper SLC2A4 reacycling after insulin stimulation
(By similarity). {ECO:0000250|UniProtKB:P14142,
ECO:0000250|UniProtKB:P19357, ECO:0000269|PubMed:11842083,
ECO:0000269|PubMed:16647043}.
-!- INTERACTION:
O43889-2:CREB3; NbExp=3; IntAct=EBI-367146, EBI-625022;
-!- SUBCELLULAR LOCATION: Cell membrane
{ECO:0000250|UniProtKB:P14142}; Multi-pass membrane protein
{ECO:0000250|UniProtKB:P14142}. Endomembrane system
{ECO:0000269|PubMed:8300557}; Multi-pass membrane protein
{ECO:0000269|PubMed:8300557}. Cytoplasm, perinuclear region
{ECO:0000250|UniProtKB:P14142}. Note=Localizes primarily to the
perinuclear region, undergoing continued recycling to the plasma
membrane where it is rapidly reinternalized (PubMed:8300557). The
dileucine internalization motif is critical for intracellular
sequestration (PubMed:8300557). Insulin stimulation induces
translocation to the cell membrane (By similarity).
{ECO:0000250|UniProtKB:P14142, ECO:0000269|PubMed:8300557}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P14672-1; Sequence=Displayed;
Name=2;
IsoId=P14672-2; Sequence=VSP_056331, VSP_056332;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Skeletal and cardiac muscles; brown and white
fat.
-!- DOMAIN: The dileucine internalization motif is critical for
intracellular sequestration. {ECO:0000269|PubMed:8300557}.
-!- PTM: Sumoylated. {ECO:0000269|PubMed:11842083}.
-!- DISEASE: Diabetes mellitus, non-insulin-dependent (NIDDM)
[MIM:125853]: A multifactorial disorder of glucose homeostasis
caused by a lack of sensitivity to the body's own insulin.
Affected individuals usually have an obese body habitus and
manifestations of a metabolic syndrome characterized by diabetes,
insulin resistance, hypertension and hypertriglyceridemia. The
disease results in long-term complications that affect the eyes,
kidneys, nerves, and blood vessels. {ECO:0000269|PubMed:1521731,
ECO:0000269|PubMed:1756912, ECO:0000269|PubMed:1918382}. Note=The
disease may be caused by mutations affecting the gene represented
in this entry.
-!- MISCELLANEOUS: Insulin-stimulated phosphorylation of TBC1D4 is
required for GLUT4 translocation. {ECO:0000250|UniProtKB:P14142}.
-!- SIMILARITY: Belongs to the major facilitator superfamily. Sugar
transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
{ECO:0000305}.
-!- WEB RESOURCE: Name=Wikipedia; Note=GLUT4 entry;
URL="https://en.wikipedia.org/wiki/Glut4";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; M20747; AAA59189.1; -; mRNA.
EMBL; M91463; AAA52569.1; -; Genomic_DNA.
EMBL; AC003688; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC034387; AAH34387.1; -; mRNA.
EMBL; BC069615; AAH69615.1; -; mRNA.
EMBL; BC069621; AAH69621.1; -; mRNA.
EMBL; BC113592; AAI13593.1; -; mRNA.
EMBL; BC126164; AAI26165.1; -; mRNA.
EMBL; X58489; CAA41399.1; -; Genomic_DNA.
CCDS; CCDS11097.1; -. [P14672-1]
PIR; A49158; A33801.
RefSeq; NP_001033.1; NM_001042.2. [P14672-1]
UniGene; Hs.380691; -.
ProteinModelPortal; P14672; -.
BioGrid; 112408; 40.
CORUM; P14672; -.
IntAct; P14672; 3.
MINT; P14672; -.
STRING; 9606.ENSP00000320935; -.
ChEMBL; CHEMBL5874; -.
DrugBank; DB09502; Fludeoxyglucose F-18.
TCDB; 2.A.1.1.80; the major facilitator superfamily (mfs).
iPTMnet; P14672; -.
PhosphoSitePlus; P14672; -.
SwissPalm; P14672; -.
BioMuta; SLC2A4; -.
DMDM; 121761; -.
EPD; P14672; -.
jPOST; P14672; -.
PaxDb; P14672; -.
PeptideAtlas; P14672; -.
PRIDE; P14672; -.
ProteomicsDB; 53073; -.
DNASU; 6517; -.
Ensembl; ENST00000317370; ENSP00000320935; ENSG00000181856. [P14672-1]
Ensembl; ENST00000572485; ENSP00000461086; ENSG00000181856. [P14672-2]
GeneID; 6517; -.
KEGG; hsa:6517; -.
UCSC; uc002gfp.4; human. [P14672-1]
CTD; 6517; -.
DisGeNET; 6517; -.
EuPathDB; HostDB:ENSG00000181856.14; -.
GeneCards; SLC2A4; -.
HGNC; HGNC:11009; SLC2A4.
HPA; CAB016544; -.
MalaCards; SLC2A4; -.
MIM; 125853; phenotype.
MIM; 138190; gene.
neXtProt; NX_P14672; -.
OpenTargets; ENSG00000181856; -.
PharmGKB; PA35879; -.
eggNOG; KOG0569; Eukaryota.
eggNOG; COG0477; LUCA.
GeneTree; ENSGT00940000160688; -.
HOGENOM; HOG000202871; -.
HOVERGEN; HBG014816; -.
InParanoid; P14672; -.
KO; K07191; -.
OMA; MSIQMWS; -.
OrthoDB; 749998at2759; -.
PhylomeDB; P14672; -.
TreeFam; TF313762; -.
Reactome; R-HSA-1445148; Translocation of SLC2A4 (GLUT4) to the plasma membrane.
Reactome; R-HSA-189200; Cellular hexose transport.
Reactome; R-HSA-381340; Transcriptional regulation of white adipocyte differentiation.
SIGNOR; P14672; -.
GeneWiki; GLUT4; -.
GenomeRNAi; 6517; -.
PRO; PR:P14672; -.
Proteomes; UP000005640; Chromosome 17.
Bgee; ENSG00000181856; Expressed in 92 organ(s), highest expression level in muscle of leg.
ExpressionAtlas; P14672; baseline and differential.
Genevisible; P14672; HS.
GO; GO:0005905; C:clathrin-coated pit; IEA:Ensembl.
GO; GO:0030136; C:clathrin-coated vesicle; IDA:UniProtKB.
GO; GO:0030659; C:cytoplasmic vesicle membrane; ISS:UniProtKB.
GO; GO:0005829; C:cytosol; IEA:Ensembl.
GO; GO:0012505; C:endomembrane system; ISS:UniProtKB.
GO; GO:0009897; C:external side of plasma membrane; IDA:MGI.
GO; GO:0070062; C:extracellular exosome; IEA:Ensembl.
GO; GO:0032593; C:insulin-responsive compartment; IDA:UniProtKB.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0016020; C:membrane; TAS:ProtInc.
GO; GO:0045121; C:membrane raft; IEA:Ensembl.
GO; GO:0005771; C:multivesicular body; IEA:Ensembl.
GO; GO:0048471; C:perinuclear region of cytoplasm; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; IDA:UniProtKB.
GO; GO:0098793; C:presynapse; IEA:Ensembl.
GO; GO:0016529; C:sarcoplasmic reticulum; IEA:Ensembl.
GO; GO:0030315; C:T-tubule; IEA:Ensembl.
GO; GO:0030140; C:trans-Golgi network transport vesicle; IEA:Ensembl.
GO; GO:0012506; C:vesicle membrane; IDA:MGI.
GO; GO:0055056; F:D-glucose transmembrane transporter activity; TAS:Reactome.
GO; GO:0005355; F:glucose transmembrane transporter activity; TAS:ProtInc.
GO; GO:0010021; P:amylopectin biosynthetic process; IEA:Ensembl.
GO; GO:0050873; P:brown fat cell differentiation; IEA:Ensembl.
GO; GO:0005975; P:carbohydrate metabolic process; TAS:ProtInc.
GO; GO:0071456; P:cellular response to hypoxia; IEA:Ensembl.
GO; GO:0032869; P:cellular response to insulin stimulus; IDA:UniProtKB.
GO; GO:0071470; P:cellular response to osmotic stress; IEA:Ensembl.
GO; GO:0071356; P:cellular response to tumor necrosis factor; IEA:Ensembl.
GO; GO:0042593; P:glucose homeostasis; IDA:BHF-UCL.
GO; GO:0046323; P:glucose import; NAS:BHF-UCL.
GO; GO:0044381; P:glucose import in response to insulin stimulus; ISS:UniProtKB.
GO; GO:1904659; P:glucose transmembrane transport; TAS:UniProtKB.
GO; GO:0098694; P:regulation of synaptic vesicle budding from presynaptic endocytic zone membrane; IEA:Ensembl.
GO; GO:0045471; P:response to ethanol; IEA:Ensembl.
CDD; cd06174; MFS; 1.
InterPro; IPR002441; Glc_transpt_4.
InterPro; IPR020846; MFS_dom.
InterPro; IPR005828; MFS_sugar_transport-like.
InterPro; IPR036259; MFS_trans_sf.
InterPro; IPR003663; Sugar/inositol_transpt.
InterPro; IPR005829; Sugar_transporter_CS.
Pfam; PF00083; Sugar_tr; 1.
PRINTS; PR01193; GLUCTRSPORT4.
PRINTS; PR00171; SUGRTRNSPORT.
SUPFAM; SSF103473; SSF103473; 1.
TIGRFAMs; TIGR00879; SP; 1.
PROSITE; PS50850; MFS; 1.
PROSITE; PS00216; SUGAR_TRANSPORT_1; 1.
PROSITE; PS00217; SUGAR_TRANSPORT_2; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome; Cytoplasm;
Diabetes mellitus; Disease mutation; Glycoprotein; Membrane;
Phosphoprotein; Polymorphism; Reference proteome; Sugar transport;
Transmembrane; Transmembrane helix; Transport; Ubl conjugation.
CHAIN 1 509 Solute carrier family 2, facilitated
glucose transporter member 4.
/FTId=PRO_0000050363.
TOPO_DOM 1 24 Cytoplasmic. {ECO:0000255}.
TRANSMEM 25 45 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 46 81 Extracellular. {ECO:0000255}.
TRANSMEM 82 102 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 103 111 Cytoplasmic. {ECO:0000255}.
TRANSMEM 112 132 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 133 142 Extracellular. {ECO:0000255}.
TRANSMEM 143 163 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 164 171 Cytoplasmic. {ECO:0000255}.
TRANSMEM 172 192 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 193 201 Extracellular. {ECO:0000255}.
TRANSMEM 202 222 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 223 287 Cytoplasmic. {ECO:0000255}.
TRANSMEM 288 308 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 309 323 Extracellular. {ECO:0000255}.
TRANSMEM 324 344 Helical; Name=8. {ECO:0000255}.
TOPO_DOM 345 353 Cytoplasmic. {ECO:0000255}.
TRANSMEM 354 374 Helical; Name=9. {ECO:0000255}.
TOPO_DOM 375 384 Extracellular. {ECO:0000255}.
TRANSMEM 385 405 Helical; Name=10. {ECO:0000255}.
TOPO_DOM 406 417 Cytoplasmic. {ECO:0000255}.
TRANSMEM 418 438 Helical; Name=11. {ECO:0000255}.
TOPO_DOM 439 445 Extracellular. {ECO:0000255}.
TRANSMEM 446 466 Helical; Name=12. {ECO:0000255}.
TOPO_DOM 467 509 Cytoplasmic. {ECO:0000255}.
REGION 7 13 SRFBP1-binding.
REGION 298 304 Monosaccharide binding. {ECO:0000250}.
MOTIF 489 490 Dileucine internalization motif.
BINDING 333 333 Monosaccharide. {ECO:0000250}.
BINDING 404 404 Monosaccharide. {ECO:0000250}.
MOD_RES 10 10 Phosphoserine.
{ECO:0000250|UniProtKB:P19357}.
MOD_RES 274 274 Phosphoserine; by SGK1.
{ECO:0000269|PubMed:17382906}.
MOD_RES 486 486 Phosphothreonine.
{ECO:0000250|UniProtKB:P14142}.
MOD_RES 488 488 Phosphoserine.
{ECO:0000250|UniProtKB:P14142}.
CARBOHYD 57 57 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:19349973}.
VAR_SEQ 342 415 LLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSY
VSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGP -> TAHL
WNGPSHWLHLPGCPGGVVGGAGGAPDAPSPGPGGHVWLCHP
DDCGSAPAGASSSHELRLHCGHLWLRGIF (in isoform
2). {ECO:0000303|PubMed:15489334}.
/FTId=VSP_056331.
VAR_SEQ 416 509 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_056332.
VARIANT 55 55 S -> R (in dbSNP:rs35198331).
/FTId=VAR_052503.
VARIANT 78 78 T -> S (in dbSNP:rs5434).
/FTId=VAR_012060.
VARIANT 358 358 A -> V (in dbSNP:rs8192702).
/FTId=VAR_020336.
VARIANT 383 383 V -> I (in NIDDM; dbSNP:rs121434581).
{ECO:0000269|PubMed:1521731,
ECO:0000269|PubMed:1756912,
ECO:0000269|PubMed:1918382}.
/FTId=VAR_007170.
VARIANT 385 385 I -> T (in dbSNP:rs775242206).
{ECO:0000269|PubMed:1397719}.
/FTId=VAR_007171.
MUTAGEN 489 490 LL->AA: Changes subcellular location
mainly to the plasma membrane.
{ECO:0000269|PubMed:8300557}.
CONFLICT 151 154 Missing (in Ref. 2; AAA52569).
{ECO:0000305}.
SEQUENCE 509 AA; 54787 MW; 8E20CD97562C1EBF CRC64;
MPSGFQQIGS EDGEPPQQRV TGTLVLAVFS AVLGSLQFGY NIGVINAPQK VIEQSYNETW
LGRQGPEGPS SIPPGTLTTL WALSVAIFSV GGMISSFLIG IISQWLGRKR AMLVNNVLAV
LGGSLMGLAN AAASYEMLIL GRFLIGAYSG LTSGLVPMYV GEIAPTHLRG ALGTLNQLAI
VIGILIAQVL GLESLLGTAS LWPLLLGLTV LPALLQLVLL PFCPESPRYL YIIQNLEGPA
RKSLKRLTGW ADVSGVLAEL KDEKRKLERE RPLSLLQLLG SRTHRQPLII AVVLQLSQQL
SGINAVFYYS TSIFETAGVG QPAYATIGAG VVNTVFTLVS VLLVERAGRR TLHLLGLAGM
CGCAILMTVA LLLLERVPAM SYVSIVAIFG FVAFFEIGPG PIPWFIVAEL FSQGPRPAAM
AVAGFSNWTS NFIIGMGFQY VAEAMGPYVF LLFAVLLLGF FIFTFLRVPE TRGRTFDQIS
AAFHRTPSLL EQEVKPSTEL EYLGPDEND


Related products :

Catalog number Product name Quantity
U2023m CLIA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023m CLIA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023r CLIA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023r CLIA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023r ELISA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023m ELISA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023m ELISA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023r ELISA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023p ELISA kit Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Pig,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4,Sus scrofa 96T
U2023p CLIA kit Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Pig,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4,Sus scrofa 96T
E2023p ELISA Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Pig,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4,Sus scrofa 96T
U2023p CLIA Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Pig,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4,Sus scrofa 96T
U2023b CLIA kit Bos taurus,Bovine,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023b ELISA kit Bos taurus,Bovine,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023b ELISA Bos taurus,Bovine,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023b CLIA Bos taurus,Bovine,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023h ELISA kit Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Homo sapiens,Human,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023h CLIA Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Homo sapiens,Human,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023h ELISA Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Homo sapiens,Human,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023h CLIA kit Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Homo sapiens,Human,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023c CLIA B146,Canis familiaris,Canis lupus familiaris,Dog,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023c CLIA kit B146,Canis familiaris,Canis lupus familiaris,Dog,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023c ELISA B146,Canis familiaris,Canis lupus familiaris,Dog,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023c ELISA kit B146,Canis familiaris,Canis lupus familiaris,Dog,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E1185h ELISA kit Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP2347: vitamin B5 (pantothenate) and CoA biosynthesis Pathway
WP2344: vitamin B6 (pyridoxine, pyridoxal, pyridoxamine) biosynthesis and salvage pathway
WP2349: vitamin B3 (niacin), NAD and NADP biosynthesis pathway
WP104: Alanine and aspartate metabolism
WP106: Alanine and aspartate metabolism
WP109: UDP-Glucose Conversion
WP1126: Tryptophan metabolism
WP1313: Insulin Signaling
WP1329: Alpha6-Beta4 Integrin Signaling Pathway
WP1348: Androgen Receptor Signaling Pathway
WP1455: Serotonin Transporter Activity
WP1493: Carbon assimilation C4 pathway
WP1545: miRNAs involved in DDR
WP1616: ABC transporters
WP1680: Oxidative phosphorylation
WP1688: Polyketide sugar unit biosynthesis
WP1689: Porphyrin and chlorophyll metabolism
WP17: daf-2 or insulin signaling pathway
WP1703: Streptomycin biosynthesis
WP1713: Two-component system
WP1935: Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds
WP2061: Fates of Glucose-6-P
WP2085: miRNAs involved in DDR
WP2248: anthocyanin biosynthesis
WP2345: vitamin B7 (biotin) biosynthesis pathway

Related Genes :
[SLC2A1 GLUT1] Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1) (HepG2 glucose transporter)
[Slc2a1 Glut-1 Glut1] Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1) (GT1)
[SLC2A11 GLUT10 GLUT11] Solute carrier family 2, facilitated glucose transporter member 11 (Glucose transporter type 10) (GLUT-10) (Glucose transporter type 11) (GLUT-11)
[Slc2a1 Glut-1 Glut1] Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1)
[Slc2a5 Glut5] Solute carrier family 2, facilitated glucose transporter member 5 (Fructose transporter) (Glucose transporter type 5, small intestine) (GLUT-5)
[SLC2A6 GLUT9] Solute carrier family 2, facilitated glucose transporter member 6 (Glucose transporter type 6) (GLUT-6) (Glucose transporter type 9) (GLUT-9)
[SLC2A1 GLUT-I GLUT1] Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1)
[SLC2A1 GLUT1] Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1) (GLUT-1) (GT1)
[Slco1b2 Oatp1b2 Slc21a10] Solute carrier organic anion transporter family member 1B2 (Liver-specific organic anion transporter 1) (rLST-1) (Sodium-independent organic anion-transporting polypeptide 4) (OATP-4) (Solute carrier family 21 member 10)
[Slco1a3 Oatp1a3 Slc21a4] Solute carrier organic anion transporter family member 1A3 (OAT-K2) (Sodium-independent organic anion transporter K1) (OAT-K1) (Solute carrier family 21 member 4) (rOAT-K)
[SLCO4C1 OATP4C1 OATPX SLC21A20] Solute carrier organic anion transporter family member 4C1 (OATP-H) (Organic anion transporter M1) (OATP-M1) (Solute carrier family 21 member 20)
[RHM2 MUM4 At1g53500 F22G10.13 T3F20.18] Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 (NDP-rhamnose synthase) (Protein MUCILAGE-MODIFIED 4) (Protein RHAMNOSE BIOSYNTHESIS 2) (Rhamnose biosynthetic enzyme 2) (AtRHM2) (UDP-L-rhamnose synthase MUM4) [Includes: UDP-glucose 4,6-dehydratase (EC 4.2.1.76); UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 4-keto-reductase (EC 1.1.1.-) (EC 5.1.3.-)]
[SLC7A5 CD98LC LAT1 MPE16] Large neutral amino acids transporter small subunit 1 (4F2 light chain) (4F2 LC) (4F2LC) (CD98 light chain) (Integral membrane protein E16) (L-type amino acid transporter 1) (hLAT1) (Solute carrier family 7 member 5) (y+ system cationic amino acid transporter)
[RHM1 ROL1 At1g78570 T30F21.10] Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 (Protein REPRESSOR OF LRX1 1) (Rhamnose biosynthetic enzyme 1) (AtRHM1) [Includes: UDP-glucose 4,6-dehydratase (EC 4.2.1.76); UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 4-keto-reductase (EC 1.1.1.-) (EC 5.1.3.-)]
[SLC7A5] Large neutral amino acids transporter small subunit 1 (4F2 light chain) (4F2 LC) (4F2LC) (L-type amino acid transporter 1) (LAT1 light chain) (Solute carrier family 7 member 5)
[SLC2A1 GLUT1] Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1)
[SLCO1B3 LST2 OATP1B3 OATP8 SLC21A8] Solute carrier organic anion transporter family member 1B3 (Liver-specific organic anion transporter 2) (LST-2) (Organic anion transporter 8) (Organic anion-transporting polypeptide 8) (OATP-8) (Solute carrier family 21 member 8)
[SLCO1B1 LST1 OATP1B1 OATP2 OATPC SLC21A6] Solute carrier organic anion transporter family member 1B1 (Liver-specific organic anion transporter 1) (LST-1) (OATP-C) (Sodium-independent organic anion-transporting polypeptide 2) (OATP-2) (Solute carrier family 21 member 6)
[SLC2A1 GLUT1] Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1)
[Slc1a5 Aaat Asct2 Slc1a7] Neutral amino acid transporter B(0) (ATB(0)) (ASC-like Na(+)-dependent neutral amino acid transporter ASCT2) (Insulin-activated amino acid transporter) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5)
[SLC2A1 GLUT-1 GLUT1] Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1) (Fragment)
[SLC22A18 BWR1A BWSCR1A HET IMPT1 ITM ORCTL2 SLC22A1L TSSC5] Solute carrier family 22 member 18 (Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene A protein) (Efflux transporter-like protein) (Imprinted multi-membrane-spanning polyspecific transporter-related protein 1) (Organic cation transporter-like protein 2) (ORCTL-2) (Solute carrier family 22 member 1-like) (Tumor-suppressing STF cDNA 5 protein) (Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein) (p45-Beckwith-Wiedemann region 1 A) (p45-BWR1A)
[Slc6a4] Sodium-dependent serotonin transporter (SERT) (5HT transporter) (5HTT) (Solute carrier family 6 member 4)
[gdh HFX_1090] Glucose 1-dehydrogenase (GDH) (GlcDH) (EC 1.1.1.47)
[Slc1a3 Eaat1 Gmt1] Excitatory amino acid transporter 1 (Glial high affinity glutamate transporter) (High-affinity neuronal glutamate transporter) (GluT-1) (Sodium-dependent glutamate/aspartate transporter 1) (GLAST-1) (Solute carrier family 1 member 3)
[Slc7a8 Lat2 Lat4] Large neutral amino acids transporter small subunit 2 (L-type amino acid transporter 2) (Solute carrier family 7 member 8)
[Slco4c1 Oatp4c1 Slc21a20] Solute carrier organic anion transporter family member 4C1 (Solute carrier family 21 member 20)
[NR1H4 BAR FXR HRR1 RIP14] Bile acid receptor (Farnesoid X-activated receptor) (Farnesol receptor HRR-1) (Nuclear receptor subfamily 1 group H member 4) (Retinoid X receptor-interacting protein 14) (RXR-interacting protein 14)
[GCK] Glucokinase (EC 2.7.1.2) (Hexokinase type IV) (HK IV) (Hexokinase-4) (HK4) (Hexokinase-D)
[Slc7a5 Lat1] Large neutral amino acids transporter small subunit 1 (4F2 light chain) (4F2 LC) (4F2LC) (L-type amino acid transporter 1) (Solute carrier family 7 member 5)

Bibliography :
[30872638] The Parkinson's disease-linked Leucine-rich repeat kinase 2 (LRRK2) is required for insulin-stimulated translocation of GLUT4.
[30829482] Fu Brick Tea Alleviates Chronic Kidney Disease of Rats with High Fat Diet Consumption through Attenuating Insulin Resistance in Skeletal Muscle.
[30813326] The Antagonist Effect of Arachidonic Acid on Gene Expression by Nuclear Receptor Type II Regulation.
[30804434] Quercetin and its metabolite isorhamnetin promote glucose uptake through different signalling pathways in myotubes.
[30729535] Effect of maternal periodontitis on GLUT4 and inflammatory pathway in adult offspring.
[30723159] Heparin affects cytosolic glucose responses of hyperglycemic dividing mesangial cells.
[30718702] Apolipoprotein A-I enhances insulin-dependent and insulin-independent glucose uptake by skeletal muscle.
[30679431] TAZ couples Hippo/Wnt signalling and insulin sensitivity through Irs1 expression.
[30660712] Viscothionin purified from mistletoe (Viscum album var. coloratum Ohwi) induces insulin secretion from pancreatic beta cells.