GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Solute carrier organic anion transporter family member 1B3 (Liver-specific organic anion transporter 2) (LST-2) (Organic anion transporter 8) (Organic anion-transporting polypeptide 8) (OATP-8) (Solute carrier family 21 member 8)

 SO1B3_HUMAN             Reviewed;         702 AA.
Q9NPD5; E7EMT8; Q5JAR4;
10-JAN-2003, integrated into UniProtKB/Swiss-Prot.
01-OCT-2000, sequence version 1.
08-MAY-2019, entry version 162.
RecName: Full=Solute carrier organic anion transporter family member 1B3;
AltName: Full=Liver-specific organic anion transporter 2;
Short=LST-2;
AltName: Full=Organic anion transporter 8;
AltName: Full=Organic anion-transporting polypeptide 8;
Short=OATP-8;
AltName: Full=Solute carrier family 21 member 8;
Name=SLCO1B3; Synonyms=LST2, OATP1B3, OATP8, SLC21A8;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), AND
GLYCOSYLATION.
TISSUE=Liver;
PubMed=10779507; DOI=10.1074/jbc.M001448200;
Koenig J., Cui Y., Nies A.T., Keppler D.;
"Localization and genomic organization of a new hepatocellular organic
anion transporting polypeptide.";
J. Biol. Chem. 275:23161-23168(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Liver;
PubMed=11375950; DOI=10.1053/gast.2001.24804;
Abe T., Unno M., Onogawa T., Tokui T., Kondo T.N., Nakagomi R.,
Adachi H., Fujiwara K., Okabe M., Suzuki T., Nunoki K., Sato E.,
Kakyo M., Nishio T., Sugita J., Asano N., Tanemoto M., Seki M.,
Date F., Ono K., Kondo Y., Shiiba K., Suzuki M., Ohtani H.,
Shimosegawa T., Iinuma K., Nagura H., Ito S., Matsuno S.;
"LST-2, a human liver-specific organic anion transporter, determines
methotrexate sensitivity in gastrointestinal cancers.";
Gastroenterology 120:1689-1699(2001).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Mizutamari H., Abe T.;
"Molecular identification of LST-3 subtype.";
Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16541075; DOI=10.1038/nature04569;
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y.,
Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C.,
Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M.,
Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L.,
Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B.,
Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D.,
Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z.,
Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z.,
Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H.,
Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H.,
Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V.,
Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J.,
Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A.,
Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M.,
Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E.,
Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K.,
Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D.,
Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M.,
Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R.,
Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J.,
Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C.,
Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M.,
Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M.,
Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P.,
Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L.,
Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E.,
Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C.,
Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F.,
Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M.,
Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S.,
Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J.,
Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A.,
Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M.,
Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I.,
Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A.,
Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D.,
Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I.,
Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T.,
Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S.,
Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D.,
Kucherlapati R., Weinstock G., Gibbs R.A.;
"The finished DNA sequence of human chromosome 12.";
Nature 440:346-351(2006).
[5]
FUNCTION, AND INVOLVEMENT IN HBLRR.
PubMed=22232210; DOI=10.1172/JCI59526;
van de Steeg E., Stranecky V., Hartmannova H., Noskova L.,
Hrebicek M., Wagenaar E., van Esch A., de Waart D.R.,
Oude Elferink R.P., Kenworthy K.E., Sticova E., al-Edreesi M.,
Knisely A.S., Kmoch S., Jirsa M., Schinkel A.H.;
"Complete OATP1B1 and OATP1B3 deficiency causes human Rotor syndrome
by interrupting conjugated bilirubin reuptake into the liver.";
J. Clin. Invest. 122:519-528(2012).
[6]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[7]
VARIANTS [LARGE SCALE ANALYSIS] MET-292 AND LEU-647.
PubMed=16959974; DOI=10.1126/science.1133427;
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
Vogelstein B., Kinzler K.W., Velculescu V.E.;
"The consensus coding sequences of human breast and colorectal
cancers.";
Science 314:268-274(2006).
-!- FUNCTION: Mediates the Na(+)-independent uptake of organic anions
such as 17-beta-glucuronosyl estradiol, taurocholate,
triiodothyronine (T3), leukotriene C4, dehydroepiandrosterone
sulfate (DHEAS), methotrexate and sulfobromophthalein (BSP).
Involved in the clearance of bile acids and organic anions from
the liver. {ECO:0000269|PubMed:22232210}.
-!- SUBCELLULAR LOCATION: Basolateral cell membrane; Multi-pass
membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9NPD5-1; Sequence=Displayed;
Name=2;
IsoId=Q9NPD5-2; Sequence=VSP_056615, VSP_056616, VSP_056617;
-!- TISSUE SPECIFICITY: Highly expressed in liver, in particular at
the basolateral membrane of hepatocytes near the central vein. Not
detected in other tissues. Highly expressed in some cancer cell
lines derived from colon, pancreas, liver and gall bladder.
-!- PTM: N-glycosylated. {ECO:0000269|PubMed:10779507}.
-!- DISEASE: Hyperbilirubinemia, Rotor type (HBLRR) [MIM:237450]: An
autosomal recessive form of primary conjugated hyperbilirubinemia.
Affected individuals develop mild jaundice not associated with
hemolysis shortly after birth or in childhood. They have delayed
plasma clearance of the unconjugated anionic dye bromsulphthalein
and prominent urinary excretion of coproporphyrin I. Hepatic
pigmentation is normal. {ECO:0000269|PubMed:22232210}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- SIMILARITY: Belongs to the organo anion transporter (TC 2.A.60)
family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AJ400763; CAB97008.1; -; Genomic_DNA.
EMBL; AJ400764; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400765; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400766; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400767; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400768; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400769; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400770; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400771; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400772; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400773; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400774; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400775; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400776; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ251506; CAB96997.1; -; mRNA.
EMBL; AF187815; AAG43445.1; -; mRNA.
EMBL; AY257471; AAP81212.1; -; mRNA.
EMBL; AY442326; AAS01768.1; -; mRNA.
EMBL; AC011604; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC087309; -; NOT_ANNOTATED_CDS; Genomic_DNA.
CCDS; CCDS8684.1; -. [Q9NPD5-1]
RefSeq; NP_062818.1; NM_019844.3. [Q9NPD5-1]
STRING; 9606.ENSP00000261196; -.
BindingDB; Q9NPD5; -.
ChEMBL; CHEMBL1743121; -.
DrugBank; DB06403; Ambrisentan.
DrugBank; DB01076; Atorvastatin.
DrugBank; DB06772; Cabazitaxel.
DrugBank; DB00520; Caspofungin.
DrugBank; DB08862; Cholecystokinin.
DrugBank; DB02659; Cholic Acid.
DrugBank; DB01211; Clarithromycin.
DrugBank; DB05239; Cobimetinib.
DrugBank; DB00286; Conjugated Equine Estrogens.
DrugBank; DB08912; Dabrafenib.
DrugBank; DB09102; Daclatasvir.
DrugBank; DB05804; dehydroepiandrosterone sulfate.
DrugBank; DB00390; Digoxin.
DrugBank; DB01248; Docetaxel.
DrugBank; DB00783; Estradiol.
DrugBank; DB00950; Fexofenadine.
DrugBank; DB01095; Fluvastatin.
DrugBank; DB08884; Gadoxetic acid.
DrugBank; DB11575; Grazoprevir.
DrugBank; DB09054; Idelalisib.
DrugBank; DB13153; Levomenol.
DrugBank; DB13139; Levosalbutamol.
DrugBank; DB00451; Levothyroxine.
DrugBank; DB00279; Liothyronine.
DrugBank; DB01583; Liotrix.
DrugBank; DB00563; Methotrexate.
DrugBank; DB00688; Mycophenolate mofetil.
DrugBank; DB02691; N-Cholylglycine.
DrugBank; DB00275; Olmesartan.
DrugBank; DB01092; Ouabain.
DrugBank; DB01229; Paclitaxel.
DrugBank; DB13154; Parachlorophenol.
DrugBank; DB01132; Pioglitazone.
DrugBank; DB08860; Pitavastatin.
DrugBank; DB00175; Pravastatin.
DrugBank; DB01045; Rifampicin.
DrugBank; DB08864; Rilpivirine.
DrugBank; DB06176; Romidepsin.
DrugBank; DB01098; Rosuvastatin.
DrugBank; DB09292; Sacubitril.
DrugBank; DB11362; Selexipag.
DrugBank; DB04348; Taurocholic Acid.
DrugBank; DB09137; Technetium Tc 99m Mebrofenin.
DrugBank; DB00177; Valsartan.
GuidetoPHARMACOLOGY; 1221; -.
TCDB; 2.A.60.1.12; the organo anion transporter (oat) family.
iPTMnet; Q9NPD5; -.
PhosphoSitePlus; Q9NPD5; -.
BioMuta; SLCO1B3; -.
DMDM; 27734563; -.
PaxDb; Q9NPD5; -.
PeptideAtlas; Q9NPD5; -.
PRIDE; Q9NPD5; -.
ProteomicsDB; 81974; -.
DNASU; 28234; -.
Ensembl; ENST00000261196; ENSP00000261196; ENSG00000111700. [Q9NPD5-1]
Ensembl; ENST00000381545; ENSP00000370956; ENSG00000111700. [Q9NPD5-1]
GeneID; 28234; -.
KEGG; hsa:28234; -.
UCSC; uc001rel.5; human. [Q9NPD5-1]
CTD; 28234; -.
DisGeNET; 28234; -.
GeneCards; SLCO1B3; -.
GeneReviews; SLCO1B3; -.
HGNC; HGNC:10961; SLCO1B3.
HPA; HPA004943; -.
HPA; HPA050892; -.
MalaCards; SLCO1B3; -.
MIM; 237450; phenotype.
MIM; 605495; gene.
neXtProt; NX_Q9NPD5; -.
OpenTargets; ENSG00000111700; -.
OpenTargets; ENSG00000257046; -.
Orphanet; 3111; Rotor syndrome.
PharmGKB; PA35844; -.
eggNOG; KOG3626; Eukaryota.
eggNOG; ENOG410XRSF; LUCA.
GeneTree; ENSGT00950000182876; -.
HOGENOM; HOG000231269; -.
InParanoid; Q9NPD5; -.
KO; K05043; -.
OMA; CNLDMQD; -.
OrthoDB; 1029129at2759; -.
PhylomeDB; Q9NPD5; -.
TreeFam; TF317540; -.
Reactome; R-HSA-159418; Recycling of bile acids and salts.
Reactome; R-HSA-5619058; Defective SLCO1B3 causes hyperbilirubinemia, Rotor type (HBLRR).
Reactome; R-HSA-879518; Transport of organic anions.
ChiTaRS; SLCO1B3; human.
GeneWiki; SLCO1B3; -.
GenomeRNAi; 28234; -.
PRO; PR:Q9NPD5; -.
Proteomes; UP000005640; Chromosome 12.
Bgee; ENSG00000111700; Expressed in 62 organ(s), highest expression level in liver.
ExpressionAtlas; Q9NPD5; baseline and differential.
Genevisible; Q9NPD5; HS.
GO; GO:0016323; C:basolateral plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0005886; C:plasma membrane; IDA:HPA.
GO; GO:0015125; F:bile acid transmembrane transporter activity; IBA:GO_Central.
GO; GO:0008514; F:organic anion transmembrane transporter activity; TAS:ProtInc.
GO; GO:0015347; F:sodium-independent organic anion transmembrane transporter activity; IBA:GO_Central.
GO; GO:0015721; P:bile acid and bile salt transport; IBA:GO_Central.
GO; GO:0015711; P:organic anion transport; TAS:ProtInc.
GO; GO:0043252; P:sodium-independent organic anion transport; IBA:GO_Central.
CDD; cd06174; MFS; 1.
InterPro; IPR002350; Kazal_dom.
InterPro; IPR036058; Kazal_dom_sf.
InterPro; IPR020846; MFS_dom.
InterPro; IPR036259; MFS_trans_sf.
InterPro; IPR004156; OATP.
PANTHER; PTHR11388; PTHR11388; 1.
Pfam; PF07648; Kazal_2; 1.
Pfam; PF03137; OATP; 1.
SUPFAM; SSF100895; SSF100895; 1.
SUPFAM; SSF103473; SSF103473; 1.
TIGRFAMs; TIGR00805; oat; 1.
PROSITE; PS51465; KAZAL_2; 1.
PROSITE; PS50850; MFS; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome;
Disulfide bond; Glycoprotein; Ion transport; Membrane; Phosphoprotein;
Polymorphism; Reference proteome; Transmembrane; Transmembrane helix;
Transport.
CHAIN 1 702 Solute carrier organic anion transporter
family member 1B3.
/FTId=PRO_0000191053.
TOPO_DOM 1 28 Cytoplasmic. {ECO:0000255}.
TRANSMEM 29 48 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 49 67 Extracellular. {ECO:0000255}.
TRANSMEM 68 88 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 89 94 Cytoplasmic. {ECO:0000255}.
TRANSMEM 95 119 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 120 168 Extracellular. {ECO:0000255}.
TRANSMEM 169 197 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 198 216 Cytoplasmic. {ECO:0000255}.
TRANSMEM 217 237 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 238 255 Extracellular. {ECO:0000255}.
TRANSMEM 256 280 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 281 331 Cytoplasmic. {ECO:0000255}.
TRANSMEM 332 353 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 354 373 Extracellular. {ECO:0000255}.
TRANSMEM 374 397 Helical; Name=8. {ECO:0000255}.
TOPO_DOM 398 401 Cytoplasmic. {ECO:0000255}.
TRANSMEM 402 425 Helical; Name=9. {ECO:0000255}.
TOPO_DOM 426 537 Extracellular. {ECO:0000255}.
TRANSMEM 538 560 Helical; Name=10. {ECO:0000255}.
TOPO_DOM 561 569 Cytoplasmic. {ECO:0000255}.
TRANSMEM 570 595 Helical; Name=11. {ECO:0000255}.
TOPO_DOM 596 629 Extracellular. {ECO:0000255}.
TRANSMEM 630 647 Helical; Name=12. {ECO:0000255}.
TOPO_DOM 648 695 Cytoplasmic. {ECO:0000255}.
DOMAIN 453 508 Kazal-like. {ECO:0000255|PROSITE-
ProRule:PRU00798}.
MOD_RES 293 293 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Y6L6}.
MOD_RES 295 295 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Y6L6}.
MOD_RES 683 683 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Y6L6}.
CARBOHYD 134 134 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 145 145 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 151 151 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 445 445 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 503 503 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 516 516 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 459 485 {ECO:0000255|PROSITE-ProRule:PRU00798}.
DISULFID 463 474 {ECO:0000255|PROSITE-ProRule:PRU00798}.
DISULFID 465 489 {ECO:0000255|PROSITE-ProRule:PRU00798}.
VAR_SEQ 622 664 GRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASDNE
RK -> GIVQPELKALAIGFHSMIMRSLGGILVPIYFGALI
DTTCMKWSTNSCGARGACRIYNSTYLGRAFFGLKVALIFPV
LVLLTVFIFVVRKKSHGKDTKVLENERQ (in isoform
2). {ECO:0000303|Ref.3}.
/FTId=VSP_056615.
VAR_SEQ 676 677 NG -> DS (in isoform 2).
{ECO:0000303|Ref.3}.
/FTId=VSP_056616.
VAR_SEQ 685 702 GTDSKTCNLDMQDNAAAN -> EEQ (in isoform 2).
{ECO:0000303|Ref.3}.
/FTId=VSP_056617.
VARIANT 112 112 S -> A (in dbSNP:rs4149117).
/FTId=VAR_024645.
VARIANT 233 233 M -> I (in dbSNP:rs7311358).
/FTId=VAR_053672.
VARIANT 256 256 G -> A (in dbSNP:rs60140950).
/FTId=VAR_062150.
VARIANT 292 292 I -> M (in a colorectal cancer sample;
somatic mutation).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036410.
VARIANT 560 560 V -> A (in dbSNP:rs12299012).
/FTId=VAR_053673.
VARIANT 647 647 M -> L (in a colorectal cancer sample;
somatic mutation; dbSNP:rs556554798).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036411.
SEQUENCE 702 AA; 77403 MW; 6D2AE371D782C7FB CRC64;
MDQHQHLNKT AESASSEKKK TRRCNGFKMF LAALSFSYIA KALGGIIMKI SITQIERRFD
ISSSLAGLID GSFEIGNLLV IVFVSYFGSK LHRPKLIGIG CLLMGTGSIL TSLPHFFMGY
YRYSKETHIN PSENSTSSLS TCLINQTLSF NGTSPEIVEK DCVKESGSHM WIYVFMGNML
RGIGETPIVP LGISYIDDFA KEGHSSLYLG SLNAIGMIGP VIGFALGSLF AKMYVDIGYV
DLSTIRITPK DSRWVGAWWL GFLVSGLFSI ISSIPFFFLP KNPNKPQKER KISLSLHVLK
TNDDRNQTAN LTNQGKNVTK NVTGFFQSLK SILTNPLYVI FLLLTLLQVS SFIGSFTYVF
KYMEQQYGQS ASHANFLLGI ITIPTVATGM FLGGFIIKKF KLSLVGIAKF SFLTSMISFL
FQLLYFPLIC ESKSVAGLTL TYDGNNSVAS HVDVPLSYCN SECNCDESQW EPVCGNNGIT
YLSPCLAGCK SSSGIKKHTV FYNCSCVEVT GLQNRNYSAH LGECPRDNTC TRKFFIYVAI
QVINSLFSAT GGTTFILLTV KIVQPELKAL AMGFQSMVIR TLGGILAPIY FGALIDKTCM
KWSTNSCGAQ GACRIYNSVF FGRVYLGLSI ALRFPALVLY IVFIFAMKKK FQGKDTKASD
NERKVMDEAN LEFLNNGEHF VPSAGTDSKT CNLDMQDNAA AN


Related products :

Catalog number Product name Quantity
EIAAB39151 Homo sapiens,Human,Liver-specific organic anion transporter 2,LST2,LST-2,OATP1B3,OATP-8,OATP8,SLC21A8,Organic anion transporter 8,Organic anion-transporting polypeptide 8,SLCO1B3,Solute carrier family
EIAAB39152 Mouse,Mus musculus,OATP-14,Oatp1c1,OATP2,Oatpf,OATP-F,Organic anion transporter 2,Organic anion transporter F,Organic anion-transporting polypeptide 14,Slc21a14,Slco1c1,Solute carrier family 21 member
EIAAB39145 Mouse,Mus musculus,Oatp1a5,Oatp3,OATP-3,Organic anion-transporting polypeptide 3,Slc21a7,Slco1a5,Sodium-independent organic anion transporter 3,Solute carrier family 21 member 7,Solute carrier organic
EIAAB39149 Liver-specific organic anion transporter 1,Oatp1b2,OATP-4,Rat,Rattus norvegicus,rLST-1,Slc21a10,Slco1b2,Sodium-independent organic anion-transporting polypeptide 4,Solute carrier family 21 member 10,S
EIAAB39147 Kidney-specific organic anion-transporting polypeptide 5,Oatp5,OATP-5,Rat,Rattus norvegicus,Slc21a13,Slco1a6,Solute carrier family 21 member 13,Solute carrier organic anion transporter family member 1
EIAAB39146 Kidney-specific organic anion-transporting polypeptide 5,Mouse,Mus musculus,Oatp5,OATP-5,Slc21a13,Slco1a6,Solute carrier family 21 member 13,Solute carrier organic anion transporter family member 1A6
EIAAB39167 Oatp4a1,Oatpe,OATP-E,Organic anion-transporting polypeptide E,Rat,Rattus norvegicus,Slc21a12,Slco4a1,Sodium-independent organic anion transporter E,Solute carrier family 21 member 12,Solute carrier or
EIAAB39139 Mouse,Mus musculus,OATP-1,Oatp1a1,Slc21a1,Slco1a1,Sodium-independent organic anion-transporting polypeptide 1,Solute carrier family 21 member 1,Solute carrier organic anion transporter family member 1
EIAAB39165 Mouse,Mus musculus,Oatp4a1,Oatpe,OATP-E,Organic anion-transporting polypeptide E,Slc21a12,Slco4a1,Sodium-independent organic anion transporter E,Solute carrier family 21 member 12,Solute carrier organ
EIAAB39162 MJAM,Mouse,Mus musculus,Oatp3a1,Oatpd,OATP-D,Organic anion-transporting polypeptide D,Slc21a11,Slco3a1,Sodium-independent organic anion transporter D,Solute carrier family 21 member 11,Solute carrier
EIAAB39138 Oatp1,OATP-1,Oatp1a1,Organic anion-transporting polypeptide 1,Rat,Rattus norvegicus,Slc21a1,Slco1a1,Sodium-independent organic anion transporter 1,Solute carrier family 21 member 1,Solute carrier orga
EIAAB39163 Bos taurus,Bovine,OATP3A1,OATPD,OATP-D,Organic anion-transporting polypeptide D,SLC21A11,SLCO3A1,Solute carrier organic anion transporter family member 3A1
EIAAB39140 Homo sapiens,Human,OATP,OATP1,OATP-1,OATP1A2,OATP-A,Organic anion-transporting polypeptide 1,SLC21A3,SLCO1A2,Sodium-independent organic anion transporter,Solute carrier family 21 member 3,Solute carri
EIAAB39171 Homo sapiens,Human,OATP5A1,OATPRP4,OATP-RP4,Organic anion transporter polypeptide-related protein 4,SLC21A15,SLCO5A1,Solute carrier family 21 member 15,Solute carrier organic anion transporter family
EIAAB39144 Oatp1a5,Oatp3,OATP-3,Organic anion-transporting polypeptide 3,Rat,Rattus norvegicus,Slc21a7,Slco1a2,Slco1a5,Sodium-independent organic anion transporter 3,Solute carrier family 21 member 7,Solute carr
EIAAB39159 Homo sapiens,Human,KIAA0880,OATP2B1,OATPB,OATP-B,OATPRP2,OATP-RP2,Organic anion transporter B,Organic anion transporter polypeptide-related protein 2,SLC21A9,SLCO2B1,Solute carrier family 21 member 9,
EIAAB39150 Liver-specific organic anion transporter 1,LST-1,Mouse,Mus musculus,Oatp1b2,Slc21a10,SLC21A6,Slco1b2,Solute carrier family 21 member 10,Solute carrier organic anion transporter family member 1B2
EIAAB39168 Homo sapiens,Human,OATP4C1,OATP-H,OATP-M1,OATPX,Organic anion transporter M1,SLC21A20,SLCO4C1,Solute carrier family 21 member 20,Solute carrier organic anion transporter family member 4C1
EIAAB39143 Mouse,Mus musculus,Oatp1a4,Oatp2,Slc21a5,Slco1a4,Sodium-independent organic anion-transporting polypeptide 2,Solute carrier family 21 member 5,Solute carrier organic anion transporter family member 1A
EIAAB39148 Homo sapiens,Human,Liver-specific organic anion transporter 1,LST1,LST-1,OATP1B1,OATP2,OATP-2,OATPC,OATP-C,SLC21A6,SLCO1B1,Sodium-independent organic anion-transporting polypeptide 2,Solute carrier fa
EIAAB39141 OAT-K1,OAT-K2,Oatp1a3,Rat,Rattus norvegicus,rOAT-K,Slc21a4,Slco1a3,Sodium-independent organic anion transporter K1,Solute carrier family 21 member 4,Solute carrier organic anion transporter family mem
EIAAB36713 hOAT1,Homo sapiens,hPAHT,hROAT1,Human,OAT1,Organic anion transporter 1,PAH transporter,PAHT,Renal organic anion transporter 1,SLC22A6,Solute carrier family 22 member 6
EIAAB36711 Bos taurus,Bovine,OAT1,Organic anion transporter 1,Renal organic anion transporter 1,ROAT1,SLC22A6,Solute carrier family 22 member 6
EIAAB36716 OAT1,Organic anion transporter 1,Pig,pOAT1,Renal organic anion transporter 1,ROAT1,SLC22A6,Solute carrier family 22 member 6,Sus scrofa
EIAAB36714 Oat1,Organic anion transporter 1,Rat,Rattus norvegicus,renal organic anion transporter 1,rOAT1,rROAT1,Slc22a6,Solute carrier family 22 member 6
Pathways :
WP2347: vitamin B5 (pantothenate) and CoA biosynthesis Pathway
WP1935: Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds
WP1616: ABC transporters
WP1713: Two-component system
WP2345: vitamin B7 (biotin) biosynthesis pathway
WP1455: Serotonin Transporter Activity
WP1689: Porphyrin and chlorophyll metabolism
WP2344: vitamin B6 (pyridoxine, pyridoxal, pyridoxamine) biosynthesis and salvage pathway
WP1493: Carbon assimilation C4 pathway
WP2349: vitamin B3 (niacin), NAD and NADP biosynthesis pathway
WP1680: Oxidative phosphorylation
WP1909: Signal regulatory protein (SIRP) family interactions
WP2199: Seed Development
WP1485: Interactions between CFTR and other ion channels
WP1834: Interactions of the immunoglobulin superfamily (IgSF) member proteins
WP211: BMP signaling pathway
WP1502: Mitochondrial biogenesis
WP1799: Costimulation by the CD28 family
WP1780: ABC-family proteins mediated transport
WP1403: AMPK signaling

Related Genes :
[SLCO1B3 LST2 OATP1B3 OATP8 SLC21A8] Solute carrier organic anion transporter family member 1B3 (Liver-specific organic anion transporter 2) (LST-2) (Organic anion transporter 8) (Organic anion-transporting polypeptide 8) (OATP-8) (Solute carrier family 21 member 8)
[SLCO1B1 LST1 OATP1B1 OATP2 OATPC SLC21A6] Solute carrier organic anion transporter family member 1B1 (Liver-specific organic anion transporter 1) (LST-1) (OATP-C) (Sodium-independent organic anion-transporting polypeptide 2) (OATP-2) (Solute carrier family 21 member 6)
[Slco1b2 Oatp1b2 Slc21a10] Solute carrier organic anion transporter family member 1B2 (Liver-specific organic anion transporter 1) (rLST-1) (Sodium-independent organic anion-transporting polypeptide 4) (OATP-4) (Solute carrier family 21 member 10)
[SLCO4C1 OATP4C1 OATPX SLC21A20] Solute carrier organic anion transporter family member 4C1 (OATP-H) (Organic anion transporter M1) (OATP-M1) (Solute carrier family 21 member 20)
[Slco1a3 Oatp1a3 Slc21a4] Solute carrier organic anion transporter family member 1A3 (OAT-K2) (Sodium-independent organic anion transporter K1) (OAT-K1) (Solute carrier family 21 member 4) (rOAT-K)
[Slco4c1 Oatp4c1 Slc21a20] Solute carrier organic anion transporter family member 4C1 (Solute carrier family 21 member 20)
[Slco1c1 Bsat1 Oatp1c1 Oatpf Slc21a14] Solute carrier organic anion transporter family member 1C1 (BBB-specific anion transporter type 1) (Blood-brain barrier-specific anion transporter 1) (Solute carrier family 21 member 14) (Thyroxine transporter)
[Slco4c1 Oatp4c1 Slc21a20] Solute carrier organic anion transporter family member 4C1 (Oatp-R) (Solute carrier family 21 member 20)
[Slc22a22 Oat-pg] Solute carrier family 22 member 22 (Prostaglandin-specific organic anion transporter)
[SLC22A1 OCT1] Solute carrier family 22 member 1 (Organic cation transporter 1) (hOCT1)
[SLC22A18 BWR1A BWSCR1A HET IMPT1 ITM ORCTL2 SLC22A1L TSSC5] Solute carrier family 22 member 18 (Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene A protein) (Efflux transporter-like protein) (Imprinted multi-membrane-spanning polyspecific transporter-related protein 1) (Organic cation transporter-like protein 2) (ORCTL-2) (Solute carrier family 22 member 1-like) (Tumor-suppressing STF cDNA 5 protein) (Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein) (p45-Beckwith-Wiedemann region 1 A) (p45-BWR1A)
[SLC22A5 OCTN2] Solute carrier family 22 member 5 (High-affinity sodium-dependent carnitine cotransporter) (Organic cation/carnitine transporter 2)
[SLC26A9] Solute carrier family 26 member 9 (Anion transporter/exchanger protein 9)
[SLC4A1 AE1 DI EPB3] Band 3 anion transport protein (Anion exchange protein 1) (AE 1) (Anion exchanger 1) (Solute carrier family 4 member 1) (CD antigen CD233)
[Slc22a1 Lx1 Oct1] Solute carrier family 22 member 1 (Organic cation transporter 1) (mOCT1)
[Slc22a1 Oct1] Solute carrier family 22 member 1 (Organic cation transporter 1) (rOCT1)
[SLC5A8 AIT SMCT SMCT1] Sodium-coupled monocarboxylate transporter 1 (Apical iodide transporter) (Electrogenic sodium monocarboxylate cotransporter) (Sodium iodide-related cotransporter) (Solute carrier family 5 member 8)
[SLC16A2 MCT8 XPCT] Monocarboxylate transporter 8 (MCT 8) (Monocarboxylate transporter 7) (MCT 7) (Solute carrier family 16 member 2) (X-linked PEST-containing transporter)
[Slc22a20 Gm963 Oat6] Solute carrier family 22 member 20 (Organic anion transporter 6)
[Slc22a12 Urat1] Solute carrier family 22 member 12 (Renal-specific transporter) (RST) (Urate anion exchanger 1)
[SLC26A11] Sodium-independent sulfate anion transporter (Solute carrier family 26 member 11)
[ABCC6 ARA MRP6] Multidrug resistance-associated protein 6 (ATP-binding cassette sub-family C member 6) (Anthracycline resistance-associated protein) (Multi-specific organic anion transporter E) (MOAT-E)
[Slc51b Ostb] Organic solute transporter subunit beta (OST-beta) (Solute carrier family 51 subunit beta)
[SLCO4C1 OATP4C1 SLC21A20] Solute carrier organic anion transporter family member 4C1 (Solute carrier family 21 member 20)
[Slc17a8 Vglut3] Vesicular glutamate transporter 3 (VGluT3) (Solute carrier family 17 member 8)
[Slc17a8 Vglut3] Vesicular glutamate transporter 3 (VGluT3) (Solute carrier family 17 member 8)
[SLC17A8 VGLUT3] Vesicular glutamate transporter 3 (VGluT3) (Solute carrier family 17 member 8)
[SLC26A1 SAT1] Sulfate anion transporter 1 (SAT-1) (Solute carrier family 26 member 1)
[Slc26a9] Solute carrier family 26 member 9 (Anion transporter/exchanger protein 9)
[Slc51a Osta] Organic solute transporter subunit alpha (OST-alpha) (Solute carrier family 51 subunit alpha)

Bibliography :