GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Steroid hormone receptor ERR2 (ERR beta-2) (Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)

 ERR2_HUMAN              Reviewed;         433 AA.
O95718; A2VDJ2; B6ZGU4; Q5F0P7; Q5F0P8; Q9HCB4;
21-FEB-2001, integrated into UniProtKB/Swiss-Prot.
07-JUN-2017, sequence version 3.
11-DEC-2019, entry version 197.
RecName: Full=Steroid hormone receptor ERR2 {ECO:0000305};
AltName: Full=ERR beta-2;
AltName: Full=Estrogen receptor-like 2;
AltName: Full=Estrogen-related receptor beta {ECO:0000303|PubMed:16332939};
Short=ERR-beta;
AltName: Full=Nuclear receptor subfamily 3 group B member 2;
Name=ESRRB {ECO:0000312|HGNC:HGNC:3473}; Synonyms=ERRB2, ESRL2, NR3B2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
TISSUE=Testis;
PubMed=10072763; DOI=10.1016/s0378-1119(98)00619-2;
Chen F., Zhang Q., McDonald T., Davidoff M.J., Bailey W., Bai C., Liu Q.,
Caskey C.T.;
"Identification of two hERR2-related novel nuclear receptors utilizing
bioinformatics and inverse PCR.";
Gene 228:101-109(1999).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), AND ALTERNATIVE SPLICING.
TISSUE=Heart, and Testis;
PubMed=16332939; DOI=10.1210/jc.2004-1957;
Zhou W., Liu Z., Wu J., Liu J.H., Hyder S.M., Antoniou E., Lubahn D.B.;
"Identification and characterization of two novel splicing isoforms of
human estrogen-related receptor beta.";
J. Clin. Endocrinol. Metab. 91:569-579(2006).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Kobayashi T., Kodani Y., Sawasaki T., Endo Y.;
"Comprehensive DNA-binding analysis of human hormone nuclear receptors by
fluorescence correlation spectroscopy based on cell-free system.";
Submitted (DEC-2008) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Testis;
Kaighin V.A., Martin A.L., Aronstam R.S.;
"Isolation of cDNA coding for multiple human nuclear receptor clones.";
Submitted (DEC-2010) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12508121; DOI=10.1038/nature01348;
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C.,
Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A.,
Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H.,
Du H., Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T.,
Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B.,
Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D.,
Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R.,
Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S.,
Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C.,
Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S.,
Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C.,
Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P.,
Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M.,
Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V.,
Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J.,
Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F.,
Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F.,
Waterston R., Hood L., Weissenbach J.;
"The DNA sequence and analysis of human chromosome 14.";
Nature 421:601-607(2003).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
FUNCTION (ISOFORM 3), AND INTERACTION WITH NFE2L2.
PubMed=17920186; DOI=10.1016/j.mce.2007.08.011;
Zhou W., Lo S.C., Liu J.H., Hannink M., Lubahn D.B.;
"ERRbeta: a potent inhibitor of Nrf2 transcriptional activity.";
Mol. Cell. Endocrinol. 278:52-62(2007).
[8]
FUNCTION, ALTERNATIVE SPLICING, AND INTERACTION WITH ESR1.
PubMed=19755138; DOI=10.1016/j.mce.2009.09.007;
Bombail V., Collins F., Brown P., Saunders P.T.;
"Modulation of ER alpha transcriptional activity by the orphan nuclear
receptor ERR beta and evidence for differential effects of long- and short-
form splice variants.";
Mol. Cell. Endocrinol. 314:53-61(2010).
[9]
FUNCTION.
PubMed=23836911; DOI=10.1074/jbc.m113.489674;
Cho Y., Hazen B.C., Russell A.P., Kralli A.;
"Peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-
1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1
(Perm1) is a tissue-specific regulator of oxidative capacity in skeletal
muscle cells.";
J. Biol. Chem. 288:25207-25218(2013).
[10]
SUBCELLULAR LOCATION.
PubMed=18775884; DOI=10.1093/humrep/den298;
Bombail V., MacPherson S., Critchley H.O., Saunders P.T.;
"Estrogen receptor related beta is expressed in human endometrium
throughout the normal menstrual cycle.";
Hum. Reprod. 23:2782-2790(2008).
[11]
ACETYLATION BY PCAF/KAT2B.
PubMed=20484414; DOI=10.1210/me.2009-0441;
Wilson B.J., Tremblay A.M., Deblois G., Sylvain-Drolet G., Giguere V.;
"An acetylation switch modulates the transcriptional activity of estrogen-
related receptor alpha.";
Mol. Endocrinol. 24:1349-1358(2010).
[12]
STRUCTURE BY NMR OF 97-194, SUBUNIT, DNA-BINDING, AND MUTAGENESIS OF
TYR-185.
PubMed=12654265; DOI=10.1016/s0022-2836(03)00183-9;
Gearhart M.D., Holmbeck S.M., Evans R.M., Dyson H.J., Wright P.E.;
"Monomeric complex of human orphan estrogen related receptor-2 with DNA: a
pseudo-dimer interface mediates extended half-site recognition.";
J. Mol. Biol. 327:819-832(2003).
[13]
VARIANTS DFNB35 VAL-110; PRO-320; LEU-342; PRO-347 AND MET-389, AND VARIANT
SER-386.
PubMed=18179891; DOI=10.1016/j.ajhg.2007.09.008;
Collin R.W.J., Kalay E., Tariq M., Peters T., van der Zwaag B.,
Venselaar H., Oostrik J., Lee K., Ahmed Z.M., Caylan R., Li Y.,
Spierenburg H.A., Eyupoglu E., Heister A., Riazuddin S., Bahat E.,
Ansar M., Arslan S., Wollnik B., Brunner H.G., Cremers C.W.R.J.,
Karaguzel A., Ahmad W., Cremers F.P.M., Vriend G., Friedman T.B.,
Riazuddin S., Leal S.M., Kremer H.;
"Mutations of ESRRB encoding estrogen-related receptor beta cause
autosomal-recessive nonsyndromic hearing impairment DFNB35.";
Am. J. Hum. Genet. 82:125-138(2008).
-!- FUNCTION: [Isoform 3]: Transcription factor that binds a canonical
ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter
and enhancer of targets genes regulating their expression or their
transcription activity (PubMed:17920186, PubMed:19755138). Plays a
role, in a LIF-independent manner, in maintainance of self-renewal and
pluripotency of embryonic and trophoblast stem cells through different
signaling pathways including FGF signaling pathway and Wnt signaling
pathways. Upon FGF signaling pathway activation, interacts with KDM1A
by directly binding to enhancer site of ELF5 and EOMES and activating
their transcription leading to self-renewal of trophoblast stem cells.
Also regulates expression of multiple rod-specific genes and is
required for survival of this cell type (By similarity). Plays a role
as transcription factor activator of GATA6, NR0B1, POU5F1 and PERM1
(PubMed:23836911). Plays a role as transcription factor repressor of
NFE2L2 transcriptional activity and ESR1 transcriptional activity
(PubMed:17920186, PubMed:19755138). During mitosis remains bound to a
subset of interphase target genes, including pluripotency regulators,
through the canonical ESRRB recognition (ERRE) sequence, leading to
their transcriptional activation in early G1 phase. Can coassemble on
structured DNA elements with other transcription factors like SOX2,
POU5F1, KDM1A and NCOA3 to trigger ESRRB-dependent gene activation.
This mechanism, in the case of SOX2 corecruitment prevents the
embryonic stem cells (ESCs) to epiblast stem cells (EpiSC) transition
through positive regulation of NR0B1 that inhibits the EpiSC
transcriptional program. Also plays a role inner ear development by
controlling expression of ion channels and transporters and in early
placentation (By similarity). {ECO:0000250|UniProtKB:Q61539,
ECO:0000269|PubMed:17920186, ECO:0000269|PubMed:19755138,
ECO:0000269|PubMed:23836911}.
-!- FUNCTION: [Isoform 1]: Transcription factor that binds a canonical
ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter
and enhancer of targets genes regulating their expression or their
transcription activity. Positively regulates ESR1 transcriptional
activity upon E2 stimulation. {ECO:0000269|PubMed:19755138}.
-!- SUBUNIT: Binds DNA as a monomer (PubMed:12654265). Interacts with
NR0B1; represses ESRRB activity at the GATA6 promoter. Interacts with
NANOG; reciprocally modulates their transcriptional activities and
activates POU5F1 expression. Interacts with NCOA3; mediates the
interaction between ESRRB and RNA polymerase II complexes and allows
NCOA3 corecruitment to ESRRB, KLF4, NANOG, and SOX2 enhancer regions to
trigger ESRRB-dependent gene activation involved in self-renewal and
pluripotency. Interacts with KDM1A; co-occupes the core set of ESRRB
targets including ELF5 and EOMES. Interacts with the multiprotein
complex Integrator, at least composed of INTS1, INTS2, INTS3, INTS4,
INTS5, INTS6, INTS7, INTS8, INTS9/RC74, INTS10, INTS11/CPSF3L and
INTS12; ESRRB is probably not a core component of the integrator
complex and associates to integrator via its interaction with INTS1 and
INTS9; attracts the transcriptional machinery. Interacts with JARID2.
Interacts with POU5F1; recruits ESRRB near the POU5F1-SOX2 element in
the NANOG proximal promoter leading to activation of NANOG expression;
the interaction is DNA independent (By similarity). Interacts with
NFE2L2; represses NFE2L2 transcriptional activity (PubMed:17920186).
Isoform 1 interacts with ESR1 (PubMed:19755138).
{ECO:0000250|UniProtKB:Q61539, ECO:0000269|PubMed:12654265,
ECO:0000269|PubMed:17920186, ECO:0000269|PubMed:19755138}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:18775884}. Cytoplasm
{ECO:0000250|UniProtKB:Q61539}. Chromosome
{ECO:0000250|UniProtKB:Q61539}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=3; Synonyms=ERRbeta-short-form {ECO:0000303|PubMed:16332939};
IsoId=O95718-3; Sequence=Displayed;
Name=1; Synonyms=ERRbeta2-delta10 {ECO:0000303|PubMed:16332939};
IsoId=O95718-1; Sequence=VSP_058967;
Name=2; Synonyms=ERRbeta2 {ECO:0000303|PubMed:16332939};
IsoId=O95718-2; Sequence=VSP_058968;
-!- PTM: Acetylated by PCAF/KAT2 (in vitro). {ECO:0000269|PubMed:20484414}.
-!- DISEASE: Deafness, autosomal recessive, 35 (DFNB35) [MIM:608565]: A
form of non-syndromic deafness characterized by non-progressive,
prelingual hearing loss. {ECO:0000269|PubMed:18179891}. Note=The
disease is caused by mutations affecting the gene represented in this
entry.
-!- MISCELLANEOUS: [Isoform 1]: Primate-specific splicing isoform.
{ECO:0000303|PubMed:16332939}.
-!- MISCELLANEOUS: [Isoform 2]: Primate-specific splicing isoform.
{ECO:0000303|PubMed:16332939}.
-!- SIMILARITY: Belongs to the nuclear hormone receptor family. NR3
subfamily. {ECO:0000305}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AF094517; AAC99409.1; -; mRNA.
EMBL; AY451389; AAS15571.1; -; mRNA.
EMBL; AY451390; AAS15572.1; -; mRNA.
EMBL; AB307714; BAH02305.1; -; mRNA.
EMBL; HQ692852; ADZ17363.1; -; mRNA.
EMBL; AC008050; AAG17472.1; -; Genomic_DNA.
EMBL; AC016543; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC131517; AAI31518.1; -; mRNA.
CCDS; CCDS9850.2; -. [O95718-1]
RefSeq; NP_004443.3; NM_004452.3. [O95718-1]
RefSeq; XP_016876575.1; XM_017021086.1.
PDB; 1LO1; NMR; -; A=97-192.
PDBsum; 1LO1; -.
SMR; O95718; -.
BioGrid; 108406; 94.
IntAct; O95718; 3.
STRING; 9606.ENSP00000422488; -.
BindingDB; O95718; -.
ChEMBL; CHEMBL3751; -.
DrugBank; DB00255; Diethylstilbestrol.
DrugBank; DB07776; Flavone.
DrugBank; DB01645; Genistein.
DrugCentral; O95718; -.
GuidetoPHARMACOLOGY; 623; -.
iPTMnet; O95718; -.
PhosphoSitePlus; O95718; -.
BioMuta; ESRRB; -.
jPOST; O95718; -.
MassIVE; O95718; -.
PaxDb; O95718; -.
PeptideAtlas; O95718; -.
PRIDE; O95718; -.
ProteomicsDB; 51011; -. [O95718-1]
ProteomicsDB; 51012; -. [O95718-2]
ProteomicsDB; 51013; -. [O95718-3]
DNASU; 2103; -.
Ensembl; ENST00000380887; ENSP00000370270; ENSG00000119715. [O95718-1]
Ensembl; ENST00000505752; ENSP00000423004; ENSG00000119715. [O95718-2]
Ensembl; ENST00000509242; ENSP00000422488; ENSG00000119715. [O95718-1]
GeneID; 2103; -.
KEGG; hsa:2103; -.
UCSC; uc001xsq.2; human. [O95718-3]
CTD; 2103; -.
DisGeNET; 2103; -.
EuPathDB; HostDB:ENSG00000119715.14; -.
GeneCards; ESRRB; -.
GeneReviews; ESRRB; -.
HGNC; HGNC:3473; ESRRB.
MalaCards; ESRRB; -.
MIM; 602167; gene.
MIM; 608565; phenotype.
neXtProt; NX_O95718; -.
OpenTargets; ENSG00000119715; -.
Orphanet; 90636; Autosomal recessive non-syndromic sensorineural deafness type DFNB.
PharmGKB; PA27889; -.
eggNOG; KOG3575; Eukaryota.
eggNOG; ENOG410XRZC; LUCA.
GeneTree; ENSGT00940000153433; -.
HOGENOM; HOG000233467; -.
InParanoid; O95718; -.
KO; K08553; -.
OMA; QIPGFIE; -.
OrthoDB; 951204at2759; -.
TreeFam; TF323751; -.
Reactome; R-HSA-383280; Nuclear Receptor transcription pathway.
SignaLink; O95718; -.
SIGNOR; O95718; -.
ChiTaRS; ESRRB; human.
EvolutionaryTrace; O95718; -.
GeneWiki; Estrogen-related_receptor_beta; -.
GenomeRNAi; 2103; -.
Pharos; O95718; Tchem.
PRO; PR:O95718; -.
Proteomes; UP000005640; Chromosome 14.
RNAct; O95718; protein.
Bgee; ENSG00000119715; Expressed in 82 organ(s), highest expression level in cortex of kidney.
ExpressionAtlas; O95718; baseline and differential.
Genevisible; O95718; HS.
GO; GO:0000793; C:condensed chromosome; ISS:UniProtKB.
GO; GO:0005737; C:cytoplasm; ISS:UniProtKB.
GO; GO:0000790; C:nuclear chromatin; ISA:NTNU_SB.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; ISS:BHF-UCL.
GO; GO:0001228; F:DNA-binding transcription activator activity, RNA polymerase II-specific; ISS:UniProtKB.
GO; GO:0003700; F:DNA-binding transcription factor activity; ISS:UniProtKB.
GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; IDA:UniProtKB.
GO; GO:0001158; F:enhancer sequence-specific DNA binding; ISS:UniProtKB.
GO; GO:0004879; F:nuclear receptor activity; TAS:ProtInc.
GO; GO:0000978; F:RNA polymerase II cis-regulatory region sequence-specific DNA binding; ISS:UniProtKB.
GO; GO:0000993; F:RNA polymerase II complex binding; ISS:UniProtKB.
GO; GO:0043565; F:sequence-specific DNA binding; IDA:UniProtKB.
GO; GO:0005496; F:steroid binding; IEA:InterPro.
GO; GO:0003707; F:steroid hormone receptor activity; IEA:InterPro.
GO; GO:0008134; F:transcription factor binding; ISS:BHF-UCL.
GO; GO:0008270; F:zinc ion binding; IEA:InterPro.
GO; GO:0043697; P:cell dedifferentiation; ISS:UniProtKB.
GO; GO:0008283; P:cell population proliferation; IDA:UniProtKB.
GO; GO:0048839; P:inner ear development; ISS:UniProtKB.
GO; GO:2000737; P:negative regulation of stem cell differentiation; ISS:UniProtKB.
GO; GO:0045494; P:photoreceptor cell maintenance; ISS:UniProtKB.
GO; GO:0045725; P:positive regulation of glycogen biosynthetic process; IEA:Ensembl.
GO; GO:0045821; P:positive regulation of glycolytic process; IEA:Ensembl.
GO; GO:1902459; P:positive regulation of stem cell population maintenance; ISS:UniProtKB.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; ISS:BHF-UCL.
GO; GO:0071931; P:positive regulation of transcription involved in G1/S transition of mitotic cell cycle; ISS:UniProtKB.
GO; GO:0090282; P:positive regulation of transcription involved in G2/M transition of mitotic cell cycle; ISS:UniProtKB.
GO; GO:0045893; P:positive regulation of transcription, DNA-templated; ISS:UniProtKB.
GO; GO:2000035; P:regulation of stem cell division; ISS:UniProtKB.
GO; GO:0006355; P:regulation of transcription, DNA-templated; IDA:UniProtKB.
GO; GO:0017145; P:stem cell division; ISS:UniProtKB.
GO; GO:0019827; P:stem cell population maintenance; IDA:UniProtKB.
GO; GO:0006367; P:transcription initiation from RNA polymerase II promoter; TAS:Reactome.
DisProt; DP01764; -.
Gene3D; 1.10.565.10; -; 1.
Gene3D; 3.30.50.10; -; 1.
InterPro; IPR035500; NHR-like_dom_sf.
InterPro; IPR000536; Nucl_hrmn_rcpt_lig-bd.
InterPro; IPR001723; Nuclear_hrmn_rcpt.
InterPro; IPR027289; Oest-rel_rcp.
InterPro; IPR024178; Oest_rcpt/oest-rel_rcp.
InterPro; IPR001628; Znf_hrmn_rcpt.
InterPro; IPR013088; Znf_NHR/GATA.
Pfam; PF00104; Hormone_recep; 1.
Pfam; PF00105; zf-C4; 1.
PIRSF; PIRSF002527; ER-like_NR; 1.
PIRSF; PIRSF500939; ERR1-2-3; 1.
PRINTS; PR00398; STRDHORMONER.
PRINTS; PR00047; STROIDFINGER.
SMART; SM00430; HOLI; 1.
SMART; SM00399; ZnF_C4; 1.
SUPFAM; SSF48508; SSF48508; 1.
PROSITE; PS51843; NR_LBD; 1.
PROSITE; PS00031; NUCLEAR_REC_DBD_1; 1.
PROSITE; PS51030; NUCLEAR_REC_DBD_2; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Chromosome; Cytoplasm;
Deafness; Disease mutation; DNA-binding; Metal-binding;
Non-syndromic deafness; Nucleus; Receptor; Reference proteome;
Transcription; Transcription regulation; Zinc; Zinc-finger.
CHAIN 1..433
/note="Steroid hormone receptor ERR2"
/id="PRO_0000053662"
DOMAIN 208..432
/note="NR LBD"
/evidence="ECO:0000255|PROSITE-ProRule:PRU01189"
DNA_BIND 100..186
/note="Nuclear receptor"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00407"
ZN_FING 103..123
/note="NR C4-type"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00407"
ZN_FING 139..163
/note="NR C4-type"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00407"
REGION 93..211
/note="Interaction with NANOG"
/evidence="ECO:0000250|UniProtKB:Q61539"
REGION 203..433
/note="Essential for ESRRB transcriptional activity and
interaction with NCOA3"
/evidence="ECO:0000250|UniProtKB:Q61539"
SITE 185
/note="Important for stabilizing DNA-binding"
VAR_SEQ 433
/note="V -> VGQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSS
PTPLNERGRQISPSTRTPGGQGKHLWLTM (in isoform 1)"
/id="VSP_058967"
VAR_SEQ 433
/note="V -> AWARADSLQEWRPLEQVPSPLHRATKRQHVHFLTPLPPPPSVAWVGT
AQAGYHLEVFLPQRAGWPRAA (in isoform 2)"
/id="VSP_058968"
VARIANT 110
/note="A -> V (in DFNB35; dbSNP:rs121909110)"
/evidence="ECO:0000269|PubMed:18179891"
/id="VAR_043503"
VARIANT 320
/note="L -> P (in DFNB35)"
/evidence="ECO:0000269|PubMed:18179891"
/id="VAR_043504"
VARIANT 342
/note="V -> L (in DFNB35; dbSNP:rs121909111)"
/evidence="ECO:0000269|PubMed:18179891"
/id="VAR_043505"
VARIANT 347
/note="L -> P (in DFNB35)"
/evidence="ECO:0000269|PubMed:18179891"
/id="VAR_043506"
VARIANT 386
/note="P -> S (in dbSNP:rs61742642)"
/evidence="ECO:0000269|PubMed:18179891"
/id="VAR_043507"
VARIANT 389
/note="T -> M (in DFNB35; uncertain pathological
significance; dbSNP:rs201714970)"
/evidence="ECO:0000269|PubMed:18179891"
/id="VAR_043508"
MUTAGEN 185
/note="Y->A: 6-fold decrease in DNA-binding affinity."
/evidence="ECO:0000269|PubMed:12654265"
CONFLICT 248
/note="D -> E (in Ref. 3; BAH02305)"
/evidence="ECO:0000305"
CONFLICT 429
/note="L -> V (in Ref. 6; AAI31518)"
/evidence="ECO:0000305"
TURN 104..107
/evidence="ECO:0000244|PDB:1LO1"
STRAND 111..119
/evidence="ECO:0000244|PDB:1LO1"
HELIX 121..132
/evidence="ECO:0000244|PDB:1LO1"
HELIX 149..154
/evidence="ECO:0000244|PDB:1LO1"
HELIX 156..166
/evidence="ECO:0000244|PDB:1LO1"
HELIX 170..172
/evidence="ECO:0000244|PDB:1LO1"
SEQUENCE 433 AA; 48054 MW; ED1D3F87E2798DD1 CRC64;
MSSDDRHLGS SCGSFIKTEP SSPSSGIDAL SHHSPSGSSD ASGGFGLALG THANGLDSPP
MFAGAGLGGT PCRKSYEDCA SGIMEDSAIK CEYMLNAIPK RLCLVCGDIA SGYHYGVASC
EACKAFFKRT IQGNIEYSCP ATNECEITKR RRKSCQACRF MKCLKVGMLK EGVRLDRVRG
GRQKYKRRLD SESSPYLSLQ ISPPAKKPLT KIVSYLLVAE PDKLYAMPPP GMPEGDIKAL
TTLCDLADRE LVVIIGWAKH IPGFSSLSLG DQMSLLQSAW MEILILGIVY RSLPYDDKLV
YAEDYIMDEE HSRLAGLLEL YRAILQLVRR YKKLKVEKEE FVTLKALALA NSDSMYIEDL
EAVQKLQDLL HEALQDYELS QRHEEPWRTG KLLLTLPLLR QTAAKAVQHF YSVKLQGKVP
MHKLFLEMLE AKV


Related products :

Catalog number Product name Quantity
EIAAB13286 Err2,ERR-beta,Esrl2,Esrrb,Estrogen receptor-like 2,Estrogen-related receptor beta,Nr3b2,Nuclear receptor subfamily 3 group B member 2,Rat,Rattus norvegicus,Steroid hormone receptor ERR2
EIAAB13285 Err2,Err-2,ERR-beta,Esrrb,Estrogen receptor-like 2,Estrogen-related receptor beta,Mouse,Mus musculus,Nr3b2,Nuclear receptor subfamily 3 group B member 2,Steroid hormone receptor ERR2
EIAAB13284 ERR beta-2,ERRB2,ERR-beta,ESRL2,ESRRB,Estrogen receptor-like 2,Estrogen-related receptor beta,Homo sapiens,Human,NR3B2,Nuclear receptor subfamily 3 group B member 2,Steroid hormone receptor ERR2
18-461-10248 Steroid hormone receptor ERR2 - Estrogen-related receptor. beta; ERR-beta; Estrogen receptor-like 2; ERR beta-2 Polyclonal 0.05 ml
18-461-10249 Steroid hormone receptor ERR2 - Estrogen-related receptor. beta; ERR-beta; Estrogen receptor-like 2; ERR beta-2 Polyclonal 0.05 ml
18-003-42074 Steroid hormone receptor ERR2 - Estrogen-related receptor. beta; ERR-beta; Estrogen receptor-like 2; ERR beta-2 Polyclonal 0.05 mg Aff Pur
18-461-10247 Steroid hormone receptor ERR2 - Estrogen-related receptor. beta; ERR-beta; Estrogen receptor-like 2; ERR beta-2 Polyclonal 0.05 ml
EIAAB13281 Err1,ERR-alpha,Esrra,Estrogen receptor-like 1,Estrogen-related receptor alpha,Estrra,Mouse,Mus musculus,Nr3b1,Nuclear receptor subfamily 3 group B member 1,Steroid hormone receptor ERR1
EIAAB13282 ERR1,ERR-alpha,ESRL1,ESRRA,Estrogen receptor-like 1,Estrogen-related receptor alpha,Homo sapiens,Human,NR3B1,Nuclear receptor subfamily 3 group B member 1,Steroid hormone receptor ERR1
EIAAB13280 ERR-alpha,Esrra,Estrogen-related receptor alpha,Nr3b1,Nuclear receptor subfamily 3 group B member 1,Rat,Rattus norvegicus,Steroid hormone receptor ERR1
EIAAB35715 Homo sapiens,Human,NR1F2,Nuclear receptor ROR-beta,Nuclear receptor RZR-beta,Nuclear receptor subfamily 1 group F member 2,Retinoid-related orphan receptor-beta,RORB,RZRB
EIAAB35716 Nr1f2,Nuclear receptor ROR-beta,Nuclear receptor RZR-beta,Nuclear receptor subfamily 1 group F member 2,Rat,Rattus norvegicus,Retinoid-related orphan receptor-beta,Rorb,Rzrb
EIAAB35714 Mouse,Mus musculus,Nr1f2,Nuclear receptor ROR-beta,Nuclear receptor RZR-beta,Nuclear receptor subfamily 1 group F member 2,Retinoid-related orphan receptor-beta,Rorb
E2300p ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2,Pig,Sus scrofa
E2300b Bos taurus,Bovine,ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2
E2300p ELISA ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2,Pig,Sus scrofa 96T
E2300p ELISA kit ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2,Pig,Sus scrofa 96T
U2300p CLIA kit ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2,Pig,Sus scrofa 96T
U2300p CLIA ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2,Pig,Sus scrofa 96T
E2300r Erbeta,ER-beta,Esr2,Estrogen receptor beta,Nr3a2,Nuclear receptor subfamily 3 group A member 2,Rat,Rattus norvegicus
U2300b CLIA kit Bos taurus,Bovine,ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2 96T
E2300m ER-beta,Esr2,Estrb,Estrogen receptor beta,Mouse,Mus musculus,Nr3a2,Nuclear receptor subfamily 3 group A member 2
E2300b ELISA Bos taurus,Bovine,ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2 96T
U2300b CLIA Bos taurus,Bovine,ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2 96T
E2300b ELISA kit Bos taurus,Bovine,ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2 96T
Pathways :
WP566: canonical wnt - zebrafish
WP926: TGF-beta Receptor Signaling Pathway
WP362: TGF-beta Receptor Signaling Pathway
WP1045: TGF-beta Receptor Signaling Pathway
WP258: TGF-beta Receptor Signaling Pathway
WP1367: TGF-beta Receptor Signaling Pathway
WP809: TGF-beta Receptor Signaling Pathway
WP1161: TGF-beta Receptor Signaling Pathway
WP1225: estrogen signalling
WP474: Endochondral Ossification
WP2272: Pathogenic Escherichia coli infection
WP2355: Corticotropin-releasing hormone
WP88: Toll Like Receptor signaling
WP732: Serotonin Receptor 2 and ELK-SRF/GATA4 signaling
WP1271: Toll-like receptor signaling pathway
WP305: Glucocorticoid Metabolism
WP780: T Cell Receptor Signaling Pathway
WP1004: Kit Receptor Signaling Pathway
WP1183: Toll-like receptor signaling pathway
WP138: Androgen receptor signaling pathway
WP2328: Allograft rejection
WP996: EPO Receptor Signaling
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP1913: Signaling by Insulin receptor
WP444: Signaling of Hepatocyte Growth Factor Receptor

Related Genes :
[Esrrb Err-2 Err2 Nr3b2] Steroid hormone receptor ERR2 (Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)
[ESRRB ERRB2 ESRL2 NR3B2] Steroid hormone receptor ERR2 (ERR beta-2) (Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)
[Esrrb Err2 Esrl2 Nr3b2] Steroid hormone receptor ERR2 (Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)
[ESRRA ERR1 ESRL1 NR3B1] Steroid hormone receptor ERR1 (Estrogen receptor-like 1) (Estrogen-related receptor alpha) (ERR-alpha) (Nuclear receptor subfamily 3 group B member 1)
[Esrra Err1 Estrra Nr3b1] Steroid hormone receptor ERR1 (Estrogen receptor-like 1) (Estrogen-related receptor alpha) (ERR-alpha) (Nuclear receptor subfamily 3 group B member 1)
[Esrra Nr3b1] Steroid hormone receptor ERR1 (Estrogen-related receptor alpha) (ERR-alpha) (Nuclear receptor subfamily 3 group B member 1)
[Esrrg Err3 Kiaa0832 Nr3b3] Estrogen-related receptor gamma (Estrogen receptor-related protein 3) (Nuclear receptor subfamily 3 group B member 3)
[ESR2 ESTRB NR3A2] Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)
[Esr2 Estrb Nr3a2] Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)
[Esr2 Erbeta Nr3a2] Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)
[NR1D2] Nuclear receptor subfamily 1 group D member 2 (Orphan nuclear hormone receptor BD73) (Rev-erb alpha-related receptor) (RVR) (Rev-erb-beta) (V-erbA-related protein 1-related) (EAR-1R)
[ESR1 ESR NR3A1] Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
[Esr1 Esr Estr Estra Nr3a1] Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
[THRB ERBA2 NR1A2 THR1] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)
[Rxrb Nr2b2] Retinoic acid receptor RXR-beta (MHC class I regulatory element-binding protein H-2RIIBP) (Nuclear receptor subfamily 2 group B member 2) (Retinoid X receptor beta)
[Thrb Erba2 Nr1a2] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)
[Esr1 Esr Estr Nr3a1] Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
[ESR1 ESR NR3A1] Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
[ESR1 ESR NR3A1] Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
[ESR1 ESR NR3A1] Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
[ESR1 ESR NR3A1] Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
[ESR1 ESR NR3A1] Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
[THRA EAR7 ERBA1 NR1A1 THRA1 THRA2] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (V-erbA-related protein 7) (EAR-7) (c-erbA-1) (c-erbA-alpha)
[ESRRA NR3B1] Steroid hormone receptor ERR1 (Estrogen-related receptor alpha) (ERR-alpha) (Nuclear receptor subfamily 3 group B member 1)
[thrb nr1a2 trb si:ch211-264a6.2] Thyroid hormone receptor beta (TR-beta) (TRb) (Nuclear receptor subfamily 1 group A member 2) (Thyroid hormone receptor beta-1) (TRbeta1)
[Nr1h2 Lxrb] Oxysterols receptor LXR-beta (Liver X receptor beta) (Nuclear receptor subfamily 1 group H member 2) (Orphan nuclear receptor OR-1) (Ubiquitously-expressed nuclear receptor) (UR)
[GPER1 CEPR CMKRL2 DRY12 GPER GPR30] G-protein coupled estrogen receptor 1 (Chemoattractant receptor-like 2) (Flow-induced endothelial G-protein coupled receptor 1) (FEG-1) (G protein-coupled estrogen receptor 1) (G-protein coupled receptor 30) (GPCR-Br) (IL8-related receptor DRY12) (Lymphocyte-derived G-protein coupled receptor) (LYGPR) (Membrane estrogen receptor) (mER)
[RORB NR1F2 RZRB] Nuclear receptor ROR-beta (Nuclear receptor RZR-beta) (Nuclear receptor subfamily 1 group F member 2) (Retinoid-related orphan receptor-beta)
[Thrb Erba2 Nr1a2] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)
[ESR1 ESR NR3A1] Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) (Fragment)

Bibliography :