GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Tetraspanin-12 (Tspan-12) (Tetraspan NET-2) (Transmembrane 4 superfamily member 12)

 TSN12_HUMAN             Reviewed;         305 AA.
O95859; A4D0V8; B4DRG6; Q549U9; Q8N5Y0;
01-DEC-2000, integrated into UniProtKB/Swiss-Prot.
01-MAY-1999, sequence version 1.
13-FEB-2019, entry version 141.
RecName: Full=Tetraspanin-12;
Short=Tspan-12;
AltName: Full=Tetraspan NET-2;
AltName: Full=Transmembrane 4 superfamily member 12;
Name=TSPAN12; Synonyms=NET2, TM4SF12; ORFNames=UNQ774/PRO1568;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=10719184; DOI=10.1016/S0167-4838(00)00022-4;
Serru V., Dessen P., Boucheix C., Rubinstein E.;
"Sequence and expression of seven new tetraspans.";
Biochim. Biophys. Acta 1478:159-163(2000).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Adrenal gland, and Teratocarcinoma;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12853948; DOI=10.1038/nature01782;
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H.,
Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R.,
Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E.,
Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H.,
Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A.,
Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J.,
Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A.,
Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S.,
Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M.,
Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C.,
Latreille P., Miller N., Johnson D., Murray J., Woessner J.P.,
Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J.,
Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L.,
Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R.,
Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E.,
Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K.,
Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S.,
Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M.,
Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R.,
Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D.,
Waterston R.H., Wilson R.K.;
"The DNA sequence of human chromosome 7.";
Nature 424:157-164(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12690205; DOI=10.1126/science.1083423;
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K.,
Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R.,
Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A.,
Kanematsu E., Gentles S., Christopoulos C.C., Choufani S.,
Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z.,
Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C.,
Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J.,
Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F.,
Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F.,
Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H.,
Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G.,
Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P.,
Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J.,
Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F.,
Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B.,
Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H.,
Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W.,
Mural R.J., Adams M.D., Tsui L.-C.;
"Human chromosome 7: DNA sequence and biology.";
Science 300:767-772(2003).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
SER-57.
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
FUNCTION, INTERACTION WITH ADAM10, PALMITOYLATION, AND MUTAGENESIS OF
CYS-9; CYS-12 AND CYS-83.
PubMed=19587294; DOI=10.1096/fj.09-133462;
Xu D., Sharma C., Hemler M.E.;
"Tetraspanin12 regulates ADAM10-dependent cleavage of amyloid
precursor protein.";
FASEB J. 23:3674-3681(2009).
[8]
FUNCTION.
PubMed=19211836; DOI=10.1091/mbc.E08-11-1149;
Lafleur M.A., Xu D., Hemler M.E.;
"Tetraspanin proteins regulate membrane type-1 matrix
metalloproteinase-dependent pericellular proteolysis.";
Mol. Biol. Cell 20:2030-2040(2009).
[9]
VARIANTS EVR5 ARG-188 AND PRO-237.
PubMed=20159111; DOI=10.1016/j.ajhg.2009.12.016;
Nikopoulos K., Gilissen C., Hoischen A., van Nouhuys C.E.,
Boonstra F.N., Blokland E.A., Arts P., Wieskamp N., Strom T.M.,
Ayuso C., Tilanus M.A., Bouwhuis S., Mukhopadhyay A., Scheffer H.,
Hoefsloot L.H., Veltman J.A., Cremers F.P., Collin R.W.;
"Next-generation sequencing of a 40 Mb linkage interval reveals
TSPAN12 mutations in patients with familial exudative
vitreoretinopathy.";
Am. J. Hum. Genet. 86:240-247(2010).
[10]
VARIANTS EVR5 HIS-101 AND ARG-210.
PubMed=20159112; DOI=10.1016/j.ajhg.2010.01.012;
Poulter J.A., Ali M., Gilmour D.F., Rice A., Kondo H., Hayashi K.,
Mackey D.A., Kearns L.S., Ruddle J.B., Craig J.E., Pierce E.A.,
Downey L.M., Mohamed M.D., Markham A.F., Inglehearn C.F., Toomes C.;
"Mutations in TSPAN12 cause autosomal-dominant familial exudative
vitreoretinopathy.";
Am. J. Hum. Genet. 86:248-253(2010).
[11]
VARIANTS EVR5 MET-49; CYS-138 AND PRO-223.
PubMed=22427576; DOI=10.1167/iovs.11-8629;
Poulter J.A., Davidson A.E., Ali M., Gilmour D.F., Parry D.A.,
Mintz-Hittner H.A., Carr I.M., Bottomley H.M., Long V.W., Downey L.M.,
Sergouniotis P.I., Wright G.A., MacLaren R.E., Moore A.T.,
Webster A.R., Inglehearn C.F., Toomes C.;
"Recessive mutations in TSPAN12 cause retinal dysplasia and severe
familial exudative vitreoretinopathy (FEVR).";
Invest. Ophthalmol. Vis. Sci. 53:2873-2879(2012).
-!- FUNCTION: Regulator of cell surface receptor signal transduction.
Plays a central role in retinal vascularization by regulating
norrin (NDP) signal transduction. Acts in concert with norrin
(NDP) to promote FZD4 multimerization and subsequent activation of
FZD4, leading to promote accumulation of beta-catenin (CTNNB1) and
stimulate LEF/TCF-mediated transcriptional programs. Suprisingly,
it only activate the norrin (NDP)-dependent activation of FZD4,
while it does not activate the Wnt-dependent activation of FZD4,
suggesting the existence of a Wnt-independent signaling that also
promote accumulation the beta-catenin (CTNNB1) (By similarity).
Acts as a regulator of membrane proteinases such as ADAM10 and
MMP14/MT1-MMP. Activates ADAM10-dependent cleavage activity of
amyloid precursor protein (APP). Activates MMP14/MT1-MMP-dependent
cleavage activity. {ECO:0000250, ECO:0000269|PubMed:19211836,
ECO:0000269|PubMed:19587294}.
-!- SUBUNIT: Component of a complex, at least composed of TSPAN12,
FZD4 and norrin (NDP) (By similarity). Interacts (when
palmitoylated) with ADAM10. Interacts with MMP14/MT1-MMP.
{ECO:0000250, ECO:0000269|PubMed:19587294}.
-!- INTERACTION:
Q12800:TFCP2; NbExp=3; IntAct=EBI-2466403, EBI-717422;
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Multi-pass
membrane protein {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=O95859-1; Sequence=Displayed;
Name=2;
IsoId=O95859-2; Sequence=VSP_038525;
Note=No experimental confirmation available.;
-!- PTM: Palmitoylated; required for interaction with ADAM10. The
precise position of palmitoylated residues is unclear and occurs
either on Cys-9, Cys-12 and/or Cys-83.
{ECO:0000269|PubMed:19587294}.
-!- DISEASE: Vitreoretinopathy, exudative 5 (EVR5) [MIM:613310]: A
disorder of the retinal vasculature characterized by an abrupt
cessation of growth of peripheral capillaries, leading to an
avascular peripheral retina. This may lead to compensatory retinal
neovascularization, which is thought to be induced by hypoxia from
the initial avascular insult. New vessels are prone to leakage and
rupture causing exudates and bleeding, followed by scarring,
retinal detachment and blindness. Clinical features can be highly
variable, even within the same family. Patients with mild forms of
the disease are asymptomatic, and their only disease related
abnormality is an arc of avascular retina in the extreme temporal
periphery. {ECO:0000269|PubMed:20159111,
ECO:0000269|PubMed:20159112, ECO:0000269|PubMed:22427576}.
Note=The disease is caused by mutations affecting the gene
represented in this entry. TSPAN12 dominant and recessive
mutations have been identified in patients with exudative
vitreoretinopathy. Patients with mutations in both alleles of
TSPAN12 have severe exudative vitreoretinopathy or retinal
dysplasia. These mutations appear to result in a milder phenotype
in heterozygous mutation carriers (PubMed:22427576).
{ECO:0000269|PubMed:22427576}.
-!- SIMILARITY: Belongs to the tetraspanin (TM4SF) family.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF124522; AAD17317.1; -; mRNA.
EMBL; AY358703; AAQ89066.1; -; mRNA.
EMBL; AK299247; BAG61278.1; -; mRNA.
EMBL; AK312239; BAG35172.1; -; mRNA.
EMBL; AC004456; AAQ96879.1; -; Genomic_DNA.
EMBL; CH236947; EAL24349.1; -; Genomic_DNA.
EMBL; BC031265; AAH31265.1; -; mRNA.
CCDS; CCDS5777.1; -. [O95859-1]
RefSeq; NP_036470.1; NM_012338.3. [O95859-1]
RefSeq; XP_005250296.1; XM_005250239.2. [O95859-1]
RefSeq; XP_011514295.1; XM_011515993.1. [O95859-1]
RefSeq; XP_011514296.1; XM_011515994.1. [O95859-1]
RefSeq; XP_016867401.1; XM_017011912.1.
UniGene; Hs.16529; -.
ProteinModelPortal; O95859; -.
BioGrid; 117098; 1.
CORUM; O95859; -.
IntAct; O95859; 21.
STRING; 9606.ENSP00000222747; -.
TCDB; 8.A.40.1.20; the tetraspanin (tetraspanin) family.
iPTMnet; O95859; -.
PhosphoSitePlus; O95859; -.
SwissPalm; O95859; -.
BioMuta; TSPAN12; -.
MaxQB; O95859; -.
PaxDb; O95859; -.
PRIDE; O95859; -.
ProteomicsDB; 51092; -.
ProteomicsDB; 51093; -. [O95859-2]
DNASU; 23554; -.
Ensembl; ENST00000222747; ENSP00000222747; ENSG00000106025. [O95859-1]
Ensembl; ENST00000415871; ENSP00000397699; ENSG00000106025. [O95859-1]
GeneID; 23554; -.
KEGG; hsa:23554; -.
UCSC; uc003vjk.4; human. [O95859-1]
CTD; 23554; -.
DisGeNET; 23554; -.
EuPathDB; HostDB:ENSG00000106025.8; -.
GeneCards; TSPAN12; -.
GeneReviews; TSPAN12; -.
HGNC; HGNC:21641; TSPAN12.
HPA; HPA051570; -.
HPA; HPA058244; -.
MalaCards; TSPAN12; -.
MIM; 613138; gene.
MIM; 613310; phenotype.
neXtProt; NX_O95859; -.
OpenTargets; ENSG00000106025; -.
Orphanet; 891; Familial exudative vitreoretinopathy.
PharmGKB; PA134954047; -.
eggNOG; KOG3882; Eukaryota.
eggNOG; ENOG4111IRY; LUCA.
GeneTree; ENSGT00510000047764; -.
HOGENOM; HOG000252919; -.
HOVERGEN; HBG054253; -.
InParanoid; O95859; -.
KO; K17355; -.
OMA; TQHLSCH; -.
OrthoDB; 993640at2759; -.
PhylomeDB; O95859; -.
TreeFam; TF316345; -.
SIGNOR; O95859; -.
ChiTaRS; TSPAN12; human.
GeneWiki; TSPAN12; -.
GenomeRNAi; 23554; -.
PRO; PR:O95859; -.
Proteomes; UP000005640; Chromosome 7.
Bgee; ENSG00000106025; Expressed in 209 organ(s), highest expression level in right adrenal gland.
ExpressionAtlas; O95859; baseline and differential.
Genevisible; O95859; HS.
GO; GO:0016021; C:integral component of membrane; TAS:ProtInc.
GO; GO:0005887; C:integral component of plasma membrane; ISS:UniProtKB.
GO; GO:0016020; C:membrane; TAS:ProtInc.
GO; GO:0001525; P:angiogenesis; IEA:UniProtKB-KW.
GO; GO:0007166; P:cell surface receptor signaling pathway; ISS:UniProtKB.
GO; GO:0045765; P:regulation of angiogenesis; ISS:UniProtKB.
GO; GO:0010842; P:retina layer formation; ISS:UniProtKB.
GO; GO:0016055; P:Wnt signaling pathway; IEA:GOC.
Gene3D; 1.10.1450.10; -; 1.
InterPro; IPR000301; Tetraspanin.
InterPro; IPR018499; Tetraspanin/Peripherin.
InterPro; IPR018503; Tetraspanin_CS.
InterPro; IPR008952; Tetraspanin_EC2_sf.
Pfam; PF00335; Tetraspanin; 1.
PIRSF; PIRSF002419; Tetraspanin; 1.
PRINTS; PR00259; TMFOUR.
SUPFAM; SSF48652; SSF48652; 1.
PROSITE; PS00421; TM4_1; 1.
1: Evidence at protein level;
Alternative splicing; Angiogenesis; Cell membrane; Complete proteome;
Disease mutation; Lipoprotein; Membrane; Palmitate; Polymorphism;
Reference proteome; Transmembrane; Transmembrane helix.
CHAIN 1 305 Tetraspanin-12.
/FTId=PRO_0000219257.
TOPO_DOM 1 12 Cytoplasmic. {ECO:0000255}.
TRANSMEM 13 33 Helical. {ECO:0000255}.
TOPO_DOM 34 59 Extracellular. {ECO:0000255}.
TRANSMEM 60 80 Helical. {ECO:0000255}.
TOPO_DOM 81 89 Cytoplasmic. {ECO:0000255}.
TRANSMEM 90 110 Helical. {ECO:0000255}.
TOPO_DOM 111 224 Extracellular. {ECO:0000255}.
TRANSMEM 225 245 Helical. {ECO:0000255}.
TOPO_DOM 246 305 Cytoplasmic. {ECO:0000255}.
LIPID 9 9 S-palmitoyl cysteine. {ECO:0000250}.
LIPID 12 12 S-palmitoyl cysteine. {ECO:0000250}.
LIPID 83 83 S-palmitoyl cysteine. {ECO:0000250}.
VAR_SEQ 1 120 MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNN
VLTLTAETRVEEAVILTYFPVVHPVMIAVCCFLIIVGMLGY
CGTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQELM ->
MAHKLLL (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_038525.
VARIANT 49 49 T -> M (in EVR5; dbSNP:rs538591733).
{ECO:0000269|PubMed:22427576}.
/FTId=VAR_068899.
VARIANT 57 57 L -> S (in dbSNP:rs17852934).
{ECO:0000269|PubMed:15489334}.
/FTId=VAR_062253.
VARIANT 101 101 L -> H (in EVR5; dbSNP:rs267607152).
{ECO:0000269|PubMed:20159112}.
/FTId=VAR_063576.
VARIANT 138 138 Y -> C (in EVR5; dbSNP:rs587777283).
{ECO:0000269|PubMed:22427576}.
/FTId=VAR_068900.
VARIANT 188 188 G -> R (in EVR5; dbSNP:rs267607151).
{ECO:0000269|PubMed:20159111}.
/FTId=VAR_063577.
VARIANT 210 210 M -> R (in EVR5).
{ECO:0000269|PubMed:20159112}.
/FTId=VAR_063578.
VARIANT 223 223 L -> P (in EVR5).
{ECO:0000269|PubMed:22427576}.
/FTId=VAR_068901.
VARIANT 237 237 A -> P (in EVR5; dbSNP:rs267607154).
{ECO:0000269|PubMed:20159111}.
/FTId=VAR_063579.
MUTAGEN 9 9 C->S: Impairs interaction with ADAM10;
when associated with S-12 and S-83.
{ECO:0000269|PubMed:19587294}.
MUTAGEN 12 12 C->S: Impairs interaction with ADAM10;
when associated with S-9 and S-83.
{ECO:0000269|PubMed:19587294}.
MUTAGEN 83 83 C->S: Impairs interaction with ADAM10;
when associated with S-9 and S-12.
{ECO:0000269|PubMed:19587294}.
SEQUENCE 305 AA; 35383 MW; EBF4D5E1371E92DC CRC64;
MAREDSVKCL RCLLYALNLL FWLMSISVLA VSAWMRDYLN NVLTLTAETR VEEAVILTYF
PVVHPVMIAV CCFLIIVGML GYCGTVKRNL LLLAWYFGSL LVIFCVELAC GVWTYEQELM
VPVQWSDMVT LKARMTNYGL PRYRWLTHAW NFFQREFKCC GVVYFTDWLE MTEMDWPPDS
CCVREFPGCS KQAHQEDLSD LYQEGCGKKM YSFLRGTKQL QVLRFLGISI GVTQILAMIL
TITLLWALYY DRREPGTDQM MSLKNDNSQH LSCPSVELLK PSLSRIFEHT SMANSFNTHF
EMEEL


Related products :

Catalog number Product name Quantity
EIAAB44276 Mouse,Mus musculus,Tetraspan NET-4,Tetraspanin-5,Tm4sf9,Transmembrane 4 superfamily member 9,Tspan5,Tspan-5
EIAAB44278 Homo sapiens,Human,Tetraspan NET-4,Tetraspanin-5,TM4SF9,Transmembrane 4 superfamily member 9,TSPAN5,Tspan-5
EIAAB44240 Homo sapiens,Human,NET2,Tetraspan NET-2,Tetraspanin-12,TM4SF12,Transmembrane 4 superfamily member 12,TSPAN12,Tspan-12,UNQ774_PRO1568
EIAAB44248 Homo sapiens,Human,NET7,Tetraspan NET-7,Tetraspanin-15,TM4SF15,Transmembrane 4 superfamily member 15,TSPAN15,Tspan-15,UNQ677_PRO1311
EIAAB44243 Homo sapiens,Human,NET6,Tetraspan NET-6,Tetraspanin-13,TM4SF13,Transmembrane 4 superfamily member 13,TSPAN13,Tspan-13,UNQ260_PRO296
EIAAB44250 F-box only protein 23,Fbxo23,Mouse,Mus musculus,Tetraspan protein SB134,Tetraspanin-17,Tm4sf17,Transmembrane 4 superfamily member 17,Tspan17,Tspan-17
EIAAB44252 F-box only protein 23,FBXO23,Homo sapiens,Human,Tetraspan protein SB134,Tetraspanin-17,TM4SF17,Transmembrane 4 superfamily member 17,TSPAN17,Tspan-17
EIAAB44249 Homo sapiens,Human,Tetraspanin TM4-B,Tetraspanin-16,TM4SF16,Transmembrane 4 superfamily member 16,TSPAN16,Tspan-16
EIAAB44262 Mouse,Mus musculus,OAP-1,OSP-associated protein 1,Tetraspanin TM4-A,Tetraspanin-3,Tm4sf8,Transmembrane 4 superfamily member 8,Tspan3,Tspan-3
EIAAB44261 Homo sapiens,Human,Tetraspanin TM4-A,Tetraspanin-3,TM4SF8,Transmembrane 4 superfamily member 8,TSPAN3,Tspan-3
15-288-22842 Tetraspanin-8 - Tspan-8; Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029 Polyclonal 0.05 mg
15-288-22842 Tetraspanin-8 - Tspan-8; Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029 Polyclonal 0.1 mg
EIAAB44238 Rat,Rattus norvegicus,Tetraspanin-12,Tm4sf12,Transmembrane 4 superfamily member 12,Tspan12,Tspan-12
EIAAB44275 Mouse,Mus musculus,Tetraspanin-4,Tm4sf7,Transmembrane 4 superfamily member 7,Tspan4,Tspan-4
EIAAB44244 Mouse,Mus musculus,Tetraspanin-13,Tm4sf13,Transmembrane 4 superfamily member 13,Tspan13,Tspan-13
EIAAB44277 Rat,Rattus norvegicus,Tetraspanin-5,Tm4sf9,Transmembrane 4 superfamily member 9,Tspan5,Tspan-5
EIAAB44242 Rat,Rattus norvegicus,Tetraspanin-13,Tm4sf13,Transmembrane 4 superfamily member 13,Tspan13,Tspan-13
EIAAB44282 Mouse,Mus musculus,Tetraspanin-6,Tm4sf6,Transmembrane 4 superfamily member 6,Tspan6,Tspan-6
EIAAB44237 Mouse,Mus musculus,Tetraspanin-12,Tm4sf12,Transmembrane 4 superfamily member 12,Tspan12,Tspan-12
EIAAB44280 A15 homolog,Homo sapiens,Human,Putative NF-kappa-B-activating protein 321,T245 protein,Tetraspanin TM4-D,Tetraspanin-6,TM4SF6,Transmembrane 4 superfamily member 6,TSPAN6,Tspan-6,UNQ767_PRO1560
EIAAB44246 D14Ertd226e,Mouse,Mus musculus,Tetraspanin-14,Tm4sf14,Transmembrane 4 superfamily member 14,Tspan14,Tspan-14
EIAAB44245 DC-TM4F2,Homo sapiens,Human,Tetraspanin-14,TM4SF14,Transmembrane 4 superfamily member 14,TSPAN14,Tspan-14
EIAAB44284 Homo sapiens,Human,Tetraspanin-8,TM4SF3,Transmembrane 4 superfamily member 3,TSPAN8,Tspan-8,Tumor-associated antigen CO-029
EIAAB44274 Homo sapiens,Human,NAG2,NAG-2,Novel antigen 2,Tetraspanin-4,TM4SF7,Transmembrane 4 superfamily member 7,TSPAN4,Tspan-4
U0751m CLIA Cell surface glycoprotein A15,Mouse,Mus musculus,Mxs1,PE31,TALLA homolog,Tetraspanin-7,Tm4sf2,Transmembrane 4 superfamily member 2,Tspan7,Tspan-7 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1834: Interactions of the immunoglobulin superfamily (IgSF) member proteins
WP1614: 1- and 2-Methylnaphthalene degradation
WP1616: ABC transporters
WP1626: Benzoate degradation via CoA ligation
WP1646: Ethylbenzene degradation
WP1665: Limonene and pinene degradation
WP1675: Nitrogen metabolism
WP1685: Peptidoglycan biosynthesis
WP1686: Phenylalanine metabolism
WP1714: Tyrosine metabolism
WP1922: SLC-mediated transmembrane transport
WP1932: Transmembrane transport of small molecules

Related Genes :
[TSPAN12 NET2 TM4SF12 UNQ774/PRO1568] Tetraspanin-12 (Tspan-12) (Tetraspan NET-2) (Transmembrane 4 superfamily member 12)
[TSPAN7 A15 DXS1692E MXS1 TM4SF2] Tetraspanin-7 (Tspan-7) (Cell surface glycoprotein A15) (Membrane component chromosome X surface marker 1) (T-cell acute lymphoblastic leukemia-associated antigen 1) (TALLA-1) (Transmembrane 4 superfamily member 2) (CD antigen CD231)
[hmp fsrB hmpA b2552 JW2536] Flavohemoprotein (Flavohemoglobin) (HMP) (Hemoglobin-like protein) (Nitric oxide dioxygenase) (NO oxygenase) (NOD) (EC 1.14.12.17)
[Tspan32 Art1 Phemx Tssc6] Tetraspanin-32 (Tspan-32) (AML1-regulated transmembrane protein 1) (Protein Phemx)
[rpsL strA b3342 JW3304] 30S ribosomal protein S12 (Small ribosomal subunit protein uS12)
[zntA yhhO b3469 JW3434] Zinc/cadmium/lead-transporting P-type ATPase (EC 3.6.3.3) (EC 7.2.2.-) (EC 7.2.2.12) (Pb(II)/Cd(II)/Zn(II)-translocating ATPase) (Zn(2+)/Cd(2+)/Pb(2+) export ATPase)
[cydB cyd-2 b0734 JW0723] Cytochrome bd-I ubiquinol oxidase subunit 2 (EC 7.1.1.7) (Cytochrome bd-I oxidase subunit II) (Cytochrome d ubiquinol oxidase subunit II)
[dinB dinP b0231 JW0221] DNA polymerase IV (Pol IV) (EC 2.7.7.7) (Translesion synthesis polymerase IV) (TSL polymerase IV)
[bcsA yhjO yhjP b3533 JW5665] Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[ribB htrP b3041 JW3009] 3,4-dihydroxy-2-butanone 4-phosphate synthase (DHBP synthase) (EC 4.1.99.12)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[CD300A CMRF35H IGSF12 HSPC083] CMRF35-like molecule 8 (CLM-8) (CD300 antigen-like family member A) (CMRF-35-H9) (CMRF35-H9) (CMRF35-H) (IRC1/IRC2) (Immunoglobulin superfamily member 12) (IgSF12) (Inhibitory receptor protein 60) (IRp60) (NK inhibitory receptor) (CD antigen CD300a)
[CD82 KAI1 SAR2 ST6 TSPAN27] CD82 antigen (C33 antigen) (IA4) (Inducible membrane protein R2) (Metastasis suppressor Kangai-1) (Suppressor of tumorigenicity 6 protein) (Tetraspanin-27) (Tspan-27) (CD antigen CD82)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[folC dedC b2315 JW2312] Dihydrofolate synthase/folylpolyglutamate synthase (DHFS / FPGS) (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[1a] Replicase polyprotein 1a (pp1a) (ORF1a polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (p28); Non-structural protein 2 (nsp2) (p65); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.69) (PL1-PRO/PL2-PRO) (PL1/PL2) (Papain-like proteinases 1/2) (p210); Non-structural protein 4 (nsp4) (Peptide HD2) (p44); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (M-PRO) (nsp5) (p27); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7) (p10); Non-structural protein 8 (nsp8) (p22); Non-structural protein 9 (nsp9) (p12); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL) (p15); Non-structural protein 11 (nsp11)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[cydA cyd-1 b0733 JW0722] Cytochrome bd-I ubiquinol oxidase subunit 1 (EC 7.1.1.7) (Cytochrome bd-I oxidase subunit I) (Cytochrome d ubiquinol oxidase subunit I)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[tsp-12 T14G10.6] Tetraspanin-12
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]

Bibliography :
?>