GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)

 THB_RAT                 Reviewed;         461 AA.
P18113; P37826;
01-NOV-1990, integrated into UniProtKB/Swiss-Prot.
01-OCT-1994, sequence version 2.
26-FEB-2020, entry version 166.
RecName: Full=Thyroid hormone receptor beta;
AltName: Full=Nuclear receptor subfamily 1 group A member 2;
AltName: Full=c-erbA-2;
AltName: Full=c-erbA-beta;
Name=Thrb; Synonyms=Erba2, Nr1a2;
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA-1).
TISSUE=Liver;
PubMed=2457590;
Murray M.B., Zilz N.D., McCreary N.L., Macdonald M.J., Towle H.C.;
"Isolation and characterization of rat cDNA clones for two distinct thyroid
hormone receptors.";
J. Biol. Chem. 263:12770-12777(1988).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA-1).
TISSUE=Pituitary;
PubMed=2899322; DOI=10.1073/pnas.85.14.5031;
Koenig R.J., Warne R.L., Brent G.A., Harney J.W., Larsen P.R., Moore D.D.;
"Isolation of a cDNA clone encoding a biologically active thyroid hormone
receptor.";
Proc. Natl. Acad. Sci. U.S.A. 85:5031-5035(1988).
[3]
NUCLEOTIDE SEQUENCE [MRNA] OF 1-121 (ISOFORM BETA-2).
TISSUE=Pituitary;
PubMed=2539642; DOI=10.1126/science.2539642;
Hodin R.A., Lazar M.A., Wintman B.I., Darling D.S., Koenig R.J.,
Larsen P.R., Moore D.D., Chin W.W.;
"Identification of a thyroid hormone receptor that is pituitary-specific.";
Science 244:76-78(1989).
[4]
INTERACTION WITH TACC1.
PubMed=20078863; DOI=10.1186/1471-2199-11-3;
Guyot R., Vincent S., Bertin J., Samarut J., Ravel-Chapuis P.;
"The transforming acidic coiled coil (TACC1) protein modulates the
transcriptional activity of the nuclear receptors TR and RAR.";
BMC Mol. Biol. 11:3-3(2010).
[5]
X-RAY CRYSTALLOGRAPHY (2.41 ANGSTROMS) OF 104-206, AND SUBUNIT.
PubMed=20610536; DOI=10.1210/me.2010-0129;
Chen Y., Young M.A.;
"Structure of a thyroid hormone receptor DNA-binding domain homodimer bound
to an inverted palindrome DNA response element.";
Mol. Endocrinol. 24:1650-1664(2010).
-!- FUNCTION: Nuclear hormone receptor that can act as a repressor or
activator of transcription. High affinity receptor for thyroid
hormones, including triiodothyronine and thyroxine.
-!- SUBUNIT: Binds DNA as a dimer; homodimer and heterodimer with RXRA (By
similarity). Interacts with the coactivators NCOA1/SRC1, NCOA2/GRIP1,
NCOA7 and MED1/TRAP220 in a ligand-inducible manner (By similarity).
Interacts with the corepressor NCOR1 in absence of ligand. Interacts
with C1D (By similarity). Interacts with NR2F6; the interaction impairs
the binding of the THRB homodimer and THRB:RXRB heterodimer to T3
response elements (By similarity). Interacts with PRMT2 and THRSP (By
similarity). Interacts with TACC1; this interaction is decreased in the
presence of thyroid hormone T3 (PubMed:20078863). {ECO:0000250,
ECO:0000269|PubMed:20078863}.
-!- SUBCELLULAR LOCATION: Nucleus.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=Beta-1;
IsoId=P18113-1; Sequence=Displayed;
Name=Beta-2;
IsoId=P18113-2, P37826-1;
Sequence=VSP_031079;
-!- DOMAIN: Composed of three domains: a modulating N-terminal domain, a
DNA-binding domain and a C-terminal ligand-binding domain.
-!- SIMILARITY: Belongs to the nuclear hormone receptor family. NR1
subfamily. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAA40916.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};
Sequence=AAA42200.1; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; J03933; AAA40916.1; ALT_INIT; mRNA.
EMBL; J03819; AAA60743.1; -; mRNA.
EMBL; M25071; AAA42200.1; ALT_INIT; mRNA.
PIR; A31820; A31820.
PIR; A41355; A41355.
PDB; 3M9E; X-ray; 2.41 A; A/B/E/F=104-206.
PDBsum; 3M9E; -.
SMR; P18113; -.
DIP; DIP-61264N; -.
IntAct; P18113; 2.
STRING; 10116.ENSRNOP00000008752; -.
BindingDB; P18113; -.
ChEMBL; CHEMBL3917; -.
DrugCentral; P18113; -.
PhosphoSitePlus; P18113; -.
PRIDE; P18113; -.
UCSC; RGD:3858; rat. [P18113-1]
RGD; 3858; Thrb.
InParanoid; P18113; -.
PhylomeDB; P18113; -.
Reactome; R-RNO-383280; Nuclear Receptor transcription pathway.
Reactome; R-RNO-4090294; SUMOylation of intracellular receptors.
EvolutionaryTrace; P18113; -.
PRO; PR:P18113; -.
Proteomes; UP000002494; Unplaced.
GO; GO:0005634; C:nucleus; ISO:RGD.
GO; GO:0090575; C:RNA polymerase II transcription factor complex; IBA:GO_Central.
GO; GO:0031490; F:chromatin DNA binding; ISO:RGD.
GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; IBA:GO_Central.
GO; GO:0003690; F:double-stranded DNA binding; IDA:RGD.
GO; GO:0019899; F:enzyme binding; ISO:RGD.
GO; GO:0042802; F:identical protein binding; IPI:RGD.
GO; GO:0098531; F:ligand-activated transcription factor activity; IBA:GO_Central.
GO; GO:0004879; F:nuclear receptor activity; IDA:RGD.
GO; GO:0030374; F:nuclear receptor transcription coactivator activity; IBA:GO_Central.
GO; GO:0000977; F:RNA polymerase II regulatory region sequence-specific DNA binding; IBA:GO_Central.
GO; GO:0038023; F:signaling receptor activity; IBA:GO_Central.
GO; GO:0003707; F:steroid hormone receptor activity; IEA:InterPro.
GO; GO:0070324; F:thyroid hormone binding; ISS:UniProtKB.
GO; GO:0008134; F:transcription factor binding; IBA:GO_Central.
GO; GO:0000976; F:transcription regulatory region sequence-specific DNA binding; IBA:GO_Central.
GO; GO:0008270; F:zinc ion binding; IEA:InterPro.
GO; GO:0009887; P:animal organ morphogenesis; ISO:RGD.
GO; GO:0030154; P:cell differentiation; IBA:GO_Central.
GO; GO:0048568; P:embryonic organ development; IEP:RGD.
GO; GO:0008050; P:female courtship behavior; ISO:RGD.
GO; GO:0009755; P:hormone-mediated signaling pathway; IBA:GO_Central.
GO; GO:0007275; P:multicellular organism development; IBA:GO_Central.
GO; GO:0042480; P:negative regulation of eye photoreceptor cell development; ISO:RGD.
GO; GO:0007621; P:negative regulation of female receptivity; ISO:RGD.
GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; ISO:RGD.
GO; GO:0045892; P:negative regulation of transcription, DNA-templated; ISO:RGD.
GO; GO:0008284; P:positive regulation of cell population proliferation; IMP:RGD.
GO; GO:0032332; P:positive regulation of chondrocyte differentiation; IDA:RGD.
GO; GO:0045778; P:positive regulation of ossification; IDA:RGD.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; ISO:RGD.
GO; GO:0090181; P:regulation of cholesterol metabolic process; IMP:RGD.
GO; GO:0008016; P:regulation of heart contraction; ISO:RGD.
GO; GO:0019216; P:regulation of lipid metabolic process; IDA:RGD.
GO; GO:0006357; P:regulation of transcription by RNA polymerase II; ISO:RGD.
GO; GO:0090207; P:regulation of triglyceride metabolic process; IMP:RGD.
GO; GO:0033993; P:response to lipid; IBA:GO_Central.
GO; GO:0097474; P:retinal cone cell apoptotic process; ISO:RGD.
GO; GO:0046549; P:retinal cone cell development; ISO:RGD.
GO; GO:0007605; P:sensory perception of sound; ISO:RGD.
GO; GO:0030878; P:thyroid gland development; IBA:GO_Central.
GO; GO:0002154; P:thyroid hormone mediated signaling pathway; IBA:GO_Central.
GO; GO:0060509; P:type I pneumocyte differentiation; ISO:RGD.
Gene3D; 1.10.565.10; -; 1.
Gene3D; 3.30.50.10; -; 1.
InterPro; IPR035500; NHR-like_dom_sf.
InterPro; IPR000536; Nucl_hrmn_rcpt_lig-bd.
InterPro; IPR001723; Nuclear_hrmn_rcpt.
InterPro; IPR001728; ThyrH_rcpt.
InterPro; IPR001628; Znf_hrmn_rcpt.
InterPro; IPR013088; Znf_NHR/GATA.
Pfam; PF00104; Hormone_recep; 1.
Pfam; PF00105; zf-C4; 1.
PRINTS; PR00398; STRDHORMONER.
PRINTS; PR00047; STROIDFINGER.
PRINTS; PR00546; THYROIDHORMR.
SMART; SM00430; HOLI; 1.
SMART; SM00399; ZnF_C4; 1.
SUPFAM; SSF48508; SSF48508; 1.
PROSITE; PS51843; NR_LBD; 1.
PROSITE; PS00031; NUCLEAR_REC_DBD_1; 1.
PROSITE; PS51030; NUCLEAR_REC_DBD_2; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; DNA-binding; Metal-binding; Nucleus;
Receptor; Reference proteome; Transcription; Transcription regulation;
Zinc; Zinc-finger.
CHAIN 1..461
/note="Thyroid hormone receptor beta"
/id="PRO_0000053450"
DOMAIN 217..461
/note="NR LBD"
/evidence="ECO:0000255|PROSITE-ProRule:PRU01189"
DNA_BIND 107..181
/note="Nuclear receptor"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00407"
ZN_FING 107..127
/note="NR C4-type"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00407"
ZN_FING 145..169
/note="NR C4-type"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00407"
REGION 1..106
/note="Modulating"
REGION 244..461
/note="Interaction with NR2F6"
/evidence="ECO:0000250"
BINDING 282
/note="Thyroid hormone"
/evidence="ECO:0000250"
BINDING 320
/note="Thyroid hormone"
/evidence="ECO:0000250"
BINDING 331
/note="Thyroid hormone; via amide nitrogen"
/evidence="ECO:0000250"
BINDING 435
/note="Thyroid hormone"
/evidence="ECO:0000250"
VAR_SEQ 1..93
/note="MTPNSMTENRLPAWDKQKPHPDRGQDWKLVGMSEACLHRKSHVERRGALKNE
QTSSHLIQATWASSIFHLDPDDVNDQSVSSAQTFQTEEKKC -> MNYCVPEVHEVCPA
AGSNRYMQVTDYLAYLEDSPAYSGCDVQAVPGSSIYLEQAWTLNQPYTCSYPGNLFKSK
DSDLDMALSQYSQPAHLPEEKPFPQVRSPPHSHK (in isoform Beta-2)"
/evidence="ECO:0000303|PubMed:2539642"
/id="VSP_031079"
CONFLICT 9..10
/note="NR -> KC (in Ref. 2; AAA60743)"
/evidence="ECO:0000305"
CONFLICT 263
/note="Q -> K (in Ref. 2; AAA60743)"
/evidence="ECO:0000305"
TURN 108..110
/evidence="ECO:0000244|PDB:3M9E"
STRAND 116..122
/evidence="ECO:0000244|PDB:3M9E"
HELIX 125..136
/evidence="ECO:0000244|PDB:3M9E"
HELIX 140..142
/evidence="ECO:0000244|PDB:3M9E"
TURN 155..159
/evidence="ECO:0000244|PDB:3M9E"
HELIX 162..171
/evidence="ECO:0000244|PDB:3M9E"
HELIX 176..178
/evidence="ECO:0000244|PDB:3M9E"
HELIX 182..202
/evidence="ECO:0000244|PDB:3M9E"
SEQUENCE 461 AA; 52656 MW; 16705C200E02995B CRC64;
MTPNSMTENR LPAWDKQKPH PDRGQDWKLV GMSEACLHRK SHVERRGALK NEQTSSHLIQ
ATWASSIFHL DPDDVNDQSV SSAQTFQTEE KKCKGYIPSY LDKDELCVVC GDKATGYHYR
CITCEGCKGF FRRTIQKSLH PSYSCKYEGK CIIDKVTRNQ CQECRFKKCI YVGMATDLVL
DDSKRLAKRK LIEENREKRR REELQKSIGH KPEPTDEEWE LIKTVTEAHV ATNAQGSHWK
QKRKFLPEDI GQAPIVNAPE GGQVDLEAFS HFTKIITPAI TRVVDFAKKL PMFCELPCED
QIILLKGCCM EIMSLRAAVR YDPDSETLTL NGEMAVTRGQ LKNGGLGVVS DAIFDLGMSL
SSFNLDDTEV ALLQAVLLMS SDRPGLACVE RIEKYQDSFL LAFEHYINYR KHHVTHFWPK
LLMKVTDLRM IGACHASRFL HMKVECPTEL FPPLFLEVFE D


Related products :

Catalog number Product name Quantity
EIAAB42233 c-erbA-2,c-erbA-beta,Erba2,Nr1a2,Nuclear receptor subfamily 1 group A member 2,Rat,Rattus norvegicus,Thrb,Thyroid hormone receptor beta
EIAAB42234 c-erbA-2,c-erbA-beta,Erba2,Mouse,Mus musculus,Nr1a2,Nuclear receptor subfamily 1 group A member 2,Thrb,Thyroid hormone receptor beta
EIAAB42232 c-erbA-2,c-erbA-beta,ERBA2,Homo sapiens,Human,NR1A2,Nuclear receptor subfamily 1 group A member 2,THR1,THRB,Thyroid hormone receptor beta
18-783-77189 RABBIT ANTI THYROID HORMONE RECEPTOR BETA 1 - Nuclear receptor subfamily 1 group A member 1; C-erbA-alpha; c-erbA-1; EAR-7; EAR7 Polyclonal 1 ml
U1927h CLIA kit c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
E1927h ELISA kit c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
E1927h ELISA c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
U1927h CLIA c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
E1927r ELISA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
E1927r ELISA c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
E1927m ELISA c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
U1927m CLIA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
U1927r CLIA c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
U1927r CLIA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
E1927m ELISA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
U1927m CLIA c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
U1927p CLIA kit c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
18-783-77191 RABBIT ANTI THYROID HORMONE RECEPTOR ALPHA 1 - TRa; Nuclear receptor subfamily 1 group A member 1; C-erbA-alpha; c-erbA-1; EAR-7; EAR7 Polyclonal 1 ml
E1927p ELISA kit c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
U1927p CLIA c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
E1927p ELISA c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
18-783-75523 RABBIT ANTI THYROID HORMONE RECEPTOR ALPHA 1 - Nuclear receptor subfamily 1 group A member 1; C-erbA-alpha; c-erbA-1; EAR-7; EAR7 Polyclonal 0.05 mg
EIAAB42231 C-ERBA-BETA,Chicken,Gallus gallus,NR1A2,Nuclear receptor subfamily 1 group A member 2,THRB,Thyroid hormone receptor beta
EIAAB27778 EAR-1R,Homo sapiens,Human,NR1D2,Nuclear receptor subfamily 1 group D member 2,Orphan nuclear hormone receptor BD73,Rev-erb-beta,V-erbA-related protein 1-related
EIAAB27776 Bos taurus,Bovine,EAR-1,NR1D1,Nuclear receptor subfamily 1 group D member 1,Rev-erbA-alpha,V-erbA-related protein 1
Pathways :
WP258: TGF-beta Receptor Signaling Pathway
WP1367: TGF-beta Receptor Signaling Pathway
WP1161: TGF-beta Receptor Signaling Pathway
WP362: TGF-beta Receptor Signaling Pathway
WP809: TGF-beta Receptor Signaling Pathway
WP1045: TGF-beta Receptor Signaling Pathway
WP566: canonical wnt - zebrafish
WP926: TGF-beta Receptor Signaling Pathway
WP474: Endochondral Ossification
WP2355: Corticotropin-releasing hormone
WP732: Serotonin Receptor 2 and ELK-SRF/GATA4 signaling
WP949: Toll-like receptor signaling pathway
WP1112: EPO Receptor Signaling
WP1345: T Cell Receptor Signaling Pathway
WP1897: Regulation of beta-cell development
WP499: Fatty Acid Beta Oxidation 3
WP829: Toll-like receptor signaling pathway
WP1004: Kit Receptor Signaling Pathway
WP1225: estrogen signalling
WP215: noncanonical wnt pathway
WP39: Fatty Acid Beta Oxidation 1
WP871: Mitochondrial LC-Fatty Acid Beta-Oxidation
WP1025: B Cell Receptor Signaling Pathway
WP1237: Fatty Acid Beta Oxidation
WP1614: 1- and 2-Methylnaphthalene degradation

Related Genes :
[THRB ERBA2 NR1A2 THR1] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)
[THRA EAR7 ERBA1 NR1A1 THRA1 THRA2] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (V-erbA-related protein 7) (EAR-7) (c-erbA-1) (c-erbA-alpha)
[Thrb Erba2 Nr1a2] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)
[Thrb Erba2 Nr1a2] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)
[NR1D2] Nuclear receptor subfamily 1 group D member 2 (Orphan nuclear hormone receptor BD73) (Rev-erb alpha-related receptor) (RVR) (Rev-erb-beta) (V-erbA-related protein 1-related) (EAR-1R)
[Thra C-erba-alpha Nr1a1] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (c-erbA-1) (c-erbA-alpha)
[THRB C-ERBA-BETA NR1A2] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2)
[Thra C-erba-alpha Nr1a1] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (c-erbA-1) (c-erbA-alpha)
[NR1D1 EAR1 HREV THRAL] Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
[THRA NR1A1] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (c-erbA-1) (c-erbA-alpha)
[Nr1d1] Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
[NR2F6 EAR2 ERBAL2] Nuclear receptor subfamily 2 group F member 6 (V-erbA-related protein 2) (EAR-2)
[thrb nr1a2 trb si:ch211-264a6.2] Thyroid hormone receptor beta (TR-beta) (TRb) (Nuclear receptor subfamily 1 group A member 2) (Thyroid hormone receptor beta-1) (TRbeta1)
[Nr1d1 Ear1] Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
[THRA NR1A1] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1)
[Nr2f6 Ear-2 Ear2 Erbal2] Nuclear receptor subfamily 2 group F member 6 (COUP transcription factor 3) (COUP-TF3) (V-erbA-related protein 2) (EAR-2)
[NR1D1] Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
[NR1D1] Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
[Nr2f6 Ear2 Erbal2] Nuclear receptor subfamily 2 group F member 6 (COUPg) (Ovalbumin upstream promoter gamma nuclear receptor) (V-erbA-related protein 2) (EAR-2)
[Nr1h2 Lxrb] Oxysterols receptor LXR-beta (Liver X receptor beta) (Nuclear receptor subfamily 1 group H member 2) (Orphan nuclear receptor OR-1) (Ubiquitously-expressed nuclear receptor) (UR)
[thra-b nr1a1-b thra2] Thyroid hormone receptor alpha-B (TRalphaB) (Nuclear receptor subfamily 1 group A member 1-B)
[Nr1d2] Nuclear receptor subfamily 1 group D member 2 (EAR4) (Rev-erb-beta)
[thra-a nr1a1-a thra1] Thyroid hormone receptor alpha-A (TRalphaA) (XenTR-alpha1) (Nuclear receptor subfamily 1 group A member 1-A)
[nhr-6 cnr-8 nr4a5 C48D5.1] Nuclear hormone receptor family member nhr-6 (Nuclear receptor subfamily 4 group A member 5) (Steroid hormone receptor family member cnr8)
[Esrrb Err-2 Err2 Nr3b2] Steroid hormone receptor ERR2 (Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)
[P4HB ERBA2L PDI PDIA1 PO4DB] Protein disulfide-isomerase (PDI) (EC 5.3.4.1) (Cellular thyroid hormone-binding protein) (Prolyl 4-hydroxylase subunit beta) (p55)
[NR4A1 GFRP1 HMR NAK1] Nuclear receptor subfamily 4 group A member 1 (Early response protein NAK1) (Nuclear hormone receptor NUR/77) (Nur77) (Orphan nuclear receptor HMR) (Orphan nuclear receptor TR3) (ST-59) (Testicular receptor 3)
[Rxrb Nr2b2] Retinoic acid receptor RXR-beta (MHC class I regulatory element-binding protein H-2RIIBP) (Nuclear receptor subfamily 2 group B member 2) (Retinoid X receptor beta)
[ESRRB ERRB2 ESRL2 NR3B2] Steroid hormone receptor ERR2 (ERR beta-2) (Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)
[ESR2 ESTRB NR3A2] Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)

Bibliography :
[32212695] Environmental pollutants modulate transcriptional activity of nuclear receptors of whales in vitro.
[32062553] Competitive binding assays for measuring the binding affinity of thyroid-disrupting chemicals for integrin αβ.
[31954205] Thyroid hormone inhibits hepatocellular carcinoma progression via induction of differentiation and metabolic reprogramming.
[31931337] Design, synthesis and biological evaluation of novel TRβ selective agonists sustained by ADME-toxicity analysis.
[31898238] Neddylation-Independent Activities of MLN4924.
[31868036] Thyromimetics as emerging therapeutic agents for nonalcoholic steatohepatitis: rationale for the development of resmetirom (MGL-3196).
[31839767] Endocrine systems of the skin.
[31812970] The association of polymorphisms of β-adrenergic receptors genes with the low triiodothyronine syndrome in patients with a heart failure.
[31760908] Thyroid Hormone Receptor β Inhibits Self-Renewal Capacity of Breast Cancer Stem Cells.
[31727409] Resmetirom (MGL-3196) for the treatment of non-alcoholic steatohepatitis: a multicentre, randomised, double-blind, placebo-controlled, phase 2 trial.