GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)

 THB_MOUSE               Reviewed;         461 AA.
P37242; P37244; Q0VDR8; Q3TY80;
01-OCT-1994, integrated into UniProtKB/Swiss-Prot.
01-OCT-1994, sequence version 1.
12-AUG-2020, entry version 182.
RecName: Full=Thyroid hormone receptor beta;
AltName: Full=Nuclear receptor subfamily 1 group A member 2;
AltName: Full=c-erbA-2;
AltName: Full=c-erbA-beta;
Name=Thrb; Synonyms=Erba2, Nr1a2;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BETA-1 AND BETA-2).
TISSUE=Thyroid;
PubMed=1944303; DOI=10.1210/mend-5-8-1049;
Wood W.M., Ocran K.W., Gordon D.F., Ridgway E.C.;
"Isolation and characterization of mouse complementary DNAs encoding alpha
and beta thyroid hormone receptors from thyrotrope cells: the mouse
pituitary-specific beta 2 isoform differs at the amino terminus from the
corresponding species from rat pituitary tumor cells.";
Mol. Endocrinol. 5:1049-1061(1991).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
STRAIN=DBA/2J; TISSUE=Liver;
PubMed=7708051; DOI=10.1210/mend.8.12.7708051;
Wood W.M., Dowding J.M., Haugen B.R., Bright T.M., Gordon D.F.,
Ridgway E.C.;
"Structural and functional characterization of the genomic locus encoding
the murine beta 2 thyroid hormone receptor.";
Mol. Endocrinol. 8:1605-1617(1994).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BETA-1).
STRAIN=C57BL/6J; TISSUE=Visual cortex;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.,
Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R.,
Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T.,
Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A.,
Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B.,
Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M.,
Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S.,
Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D.,
Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M.,
Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H.,
Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V.,
Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S.,
Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H.,
Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N.,
Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F.,
Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G.,
Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z.,
Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S.,
Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K.,
Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R.,
van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H.,
Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M.,
Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C.,
Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S.,
Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K.,
Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M.,
Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C.,
Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A.,
Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BETA-2).
STRAIN=C57BL/6J; TISSUE=Eye;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
INTERACTION WITH C1D.
PubMed=9405624; DOI=10.1073/pnas.94.26.14400;
Zamir I., Dawson J., Lavinsky R.M., Glass C.K., Rosenfeld M.G., Lazar M.A.;
"Cloning and characterization of a corepressor and potential component of
the nuclear hormone receptor repression complex.";
Proc. Natl. Acad. Sci. U.S.A. 94:14400-14405(1997).
-!- FUNCTION: Nuclear hormone receptor that can act as a repressor or
activator of transcription. High affinity receptor for thyroid
hormones, including triiodothyronine and thyroxine.
-!- SUBUNIT: Binds DNA as a dimer; homodimer and heterodimer with RXRB.
Interacts with the coactivators NCOA1/SRC1, NCOA2/GRIP1, NCOA7 and
MED1/TRAP220 in a ligand-inducible manner. Interacts with the
corepressor NCOR1 in absence of ligand (By similarity). Interacts with
C1D. Interacts with NR2F6; the interaction impairs the binding of the
THRB homodimer and THRB:RXRB heterodimer to T3 response elements.
Interacts with PRMT2 and THRSP (By similarity). Interacts with TACC1;
this interaction is decreased in the presence of thyroid hormone T3 (By
similarity). {ECO:0000250, ECO:0000250|UniProtKB:P10828}.
-!- INTERACTION:
P37242; O08915: Aip; NbExp=2; IntAct=EBI-6935043, EBI-6935014;
-!- SUBCELLULAR LOCATION: Nucleus.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=Beta-1;
IsoId=P37242-1; Sequence=Displayed;
Name=Beta-2;
IsoId=P37242-2, P37244-1;
Sequence=VSP_031078;
-!- DOMAIN: Composed of three domains: a modulating N-terminal domain, a
DNA-binding domain and a C-terminal ligand-binding domain.
-!- SIMILARITY: Belongs to the nuclear hormone receptor family. NR1
subfamily. {ECO:0000305}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; S62756; AAB20226.1; -; mRNA.
EMBL; S62758; AAB20227.1; -; mRNA.
EMBL; U15548; AAA86957.1; -; Genomic_DNA.
EMBL; U15542; AAA86957.1; JOINED; Genomic_DNA.
EMBL; U15543; AAA86957.1; JOINED; Genomic_DNA.
EMBL; U15544; AAA86957.1; JOINED; Genomic_DNA.
EMBL; U15545; AAA86957.1; JOINED; Genomic_DNA.
EMBL; U15546; AAA86957.1; JOINED; Genomic_DNA.
EMBL; U15547; AAA86957.1; JOINED; Genomic_DNA.
EMBL; AK158826; BAE34683.1; -; mRNA.
EMBL; BC089035; AAH89035.1; -; mRNA.
EMBL; BC119552; AAI19553.1; -; mRNA.
EMBL; BC119553; AAI19554.1; -; mRNA.
CCDS; CCDS26835.1; -. [P37242-2]
CCDS; CCDS49404.1; -. [P37242-1]
PIR; A40377; A40377.
PIR; A57035; A57035.
RefSeq; NP_001106888.1; NM_001113417.1. [P37242-1]
RefSeq; NP_033406.1; NM_009380.3. [P37242-2]
RefSeq; XP_006518029.1; XM_006517966.2. [P37242-1]
RefSeq; XP_006518030.1; XM_006517967.3. [P37242-1]
RefSeq; XP_006518031.1; XM_006517968.3. [P37242-1]
RefSeq; XP_006518033.1; XM_006517970.3. [P37242-1]
RefSeq; XP_006518034.1; XM_006517971.3. [P37242-1]
RefSeq; XP_006518035.1; XM_006517972.3. [P37242-1]
RefSeq; XP_011243039.1; XM_011244737.1. [P37242-1]
RefSeq; XP_011243040.1; XM_011244738.2. [P37242-1]
RefSeq; XP_011243041.1; XM_011244739.2. [P37242-1]
RefSeq; XP_011243042.1; XM_011244740.2. [P37242-1]
RefSeq; XP_011243043.1; XM_011244741.2. [P37242-1]
RefSeq; XP_011243044.1; XM_011244742.1. [P37242-1]
RefSeq; XP_011243045.1; XM_011244743.2. [P37242-1]
RefSeq; XP_017171435.1; XM_017315946.1.
RefSeq; XP_017171436.1; XM_017315947.1. [P37242-1]
SMR; P37242; -.
BioGRID; 204184; 10.
ComplexPortal; CPX-710; RXRalpha-TRbeta nuclear hormone receptor complex.
DIP; DIP-43750N; -.
IntAct; P37242; 4.
MINT; P37242; -.
STRING; 10090.ENSMUSP00000022304; -.
PhosphoSitePlus; P37242; -.
MaxQB; P37242; -.
PaxDb; P37242; -.
PRIDE; P37242; -.
Antibodypedia; 4548; 485 antibodies.
Ensembl; ENSMUST00000022303; ENSMUSP00000022303; ENSMUSG00000021779. [P37242-1]
Ensembl; ENSMUST00000022304; ENSMUSP00000022304; ENSMUSG00000021779. [P37242-2]
Ensembl; ENSMUST00000091471; ENSMUSP00000089053; ENSMUSG00000021779. [P37242-1]
GeneID; 21834; -.
KEGG; mmu:21834; -.
UCSC; uc007shk.2; mouse. [P37242-1]
UCSC; uc007sho.2; mouse. [P37242-2]
CTD; 7068; -.
MGI; MGI:98743; Thrb.
eggNOG; KOG3575; Eukaryota.
GeneTree; ENSGT00940000156809; -.
HOGENOM; CLU_007368_18_2_1; -.
InParanoid; P37242; -.
KO; K08362; -.
OMA; CMQELYE; -.
OrthoDB; 1112927at2759; -.
PhylomeDB; P37242; -.
TreeFam; TF328382; -.
Reactome; R-MMU-383280; Nuclear Receptor transcription pathway.
Reactome; R-MMU-4090294; SUMOylation of intracellular receptors.
BioGRID-ORCS; 21834; 2 hits in 20 CRISPR screens.
ChiTaRS; Thrb; mouse.
PRO; PR:P37242; -.
Proteomes; UP000000589; Chromosome 14.
RNAct; P37242; protein.
Bgee; ENSMUSG00000021779; Expressed in spiral organ of cochlea and 94 other tissues.
ExpressionAtlas; P37242; baseline and differential.
Genevisible; P37242; MM.
GO; GO:0042025; C:host cell nucleus; IEA:InterPro.
GO; GO:0016604; C:nuclear body; ISO:MGI.
GO; GO:0005634; C:nucleus; IDA:MGI.
GO; GO:0090575; C:RNA polymerase II transcription regulator complex; IBA:GO_Central.
GO; GO:0031490; F:chromatin DNA binding; IDA:MGI.
GO; GO:0003700; F:DNA-binding transcription factor activity; TAS:MGI.
GO; GO:0003690; F:double-stranded DNA binding; ISO:MGI.
GO; GO:0019899; F:enzyme binding; ISO:MGI.
GO; GO:0042802; F:identical protein binding; ISO:MGI.
GO; GO:0004879; F:nuclear receptor activity; IMP:MGI.
GO; GO:0000977; F:RNA polymerase II transcription regulatory region sequence-specific DNA binding; IBA:GO_Central.
GO; GO:0038023; F:signaling receptor activity; IBA:GO_Central.
GO; GO:0003707; F:steroid hormone receptor activity; IEA:InterPro.
GO; GO:0070324; F:thyroid hormone binding; ISS:UniProtKB.
GO; GO:0008134; F:transcription factor binding; IBA:GO_Central.
GO; GO:0008270; F:zinc ion binding; IEA:InterPro.
GO; GO:0009887; P:animal organ morphogenesis; IMP:MGI.
GO; GO:0030154; P:cell differentiation; IBA:GO_Central.
GO; GO:0008050; P:female courtship behavior; IMP:MGI.
GO; GO:0009755; P:hormone-mediated signaling pathway; IBA:GO_Central.
GO; GO:0042480; P:negative regulation of eye photoreceptor cell development; IMP:MGI.
GO; GO:0007621; P:negative regulation of female receptivity; IMP:MGI.
GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; IGI:MGI.
GO; GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:MGI.
GO; GO:0008284; P:positive regulation of cell population proliferation; ISO:MGI.
GO; GO:0032332; P:positive regulation of chondrocyte differentiation; ISO:MGI.
GO; GO:0045778; P:positive regulation of ossification; ISO:MGI.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IGI:MGI.
GO; GO:0090181; P:regulation of cholesterol metabolic process; ISO:MGI.
GO; GO:0008016; P:regulation of heart contraction; IMP:MGI.
GO; GO:0019216; P:regulation of lipid metabolic process; ISO:MGI.
GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IGI:MGI.
GO; GO:0006355; P:regulation of transcription, DNA-templated; TAS:MGI.
GO; GO:0090207; P:regulation of triglyceride metabolic process; ISO:MGI.
GO; GO:0097474; P:retinal cone cell apoptotic process; IMP:MGI.
GO; GO:0046549; P:retinal cone cell development; IMP:MGI.
GO; GO:0007605; P:sensory perception of sound; IMP:MGI.
GO; GO:0002154; P:thyroid hormone mediated signaling pathway; IBA:GO_Central.
GO; GO:0060509; P:type I pneumocyte differentiation; IGI:MGI.
Gene3D; 1.10.565.10; -; 1.
Gene3D; 3.30.50.10; -; 1.
InterPro; IPR035500; NHR-like_dom_sf.
InterPro; IPR000536; Nucl_hrmn_rcpt_lig-bd.
InterPro; IPR001723; Nuclear_hrmn_rcpt.
InterPro; IPR001728; ThyrH_rcpt.
InterPro; IPR001628; Znf_hrmn_rcpt.
InterPro; IPR013088; Znf_NHR/GATA.
Pfam; PF00104; Hormone_recep; 1.
Pfam; PF00105; zf-C4; 1.
PRINTS; PR00398; STRDHORMONER.
PRINTS; PR00047; STROIDFINGER.
PRINTS; PR00546; THYROIDHORMR.
SMART; SM00430; HOLI; 1.
SMART; SM00399; ZnF_C4; 1.
SUPFAM; SSF48508; SSF48508; 1.
PROSITE; PS51843; NR_LBD; 1.
PROSITE; PS00031; NUCLEAR_REC_DBD_1; 1.
PROSITE; PS51030; NUCLEAR_REC_DBD_2; 1.
1: Evidence at protein level;
Alternative splicing; DNA-binding; Metal-binding; Nucleus; Receptor;
Reference proteome; Transcription; Transcription regulation; Zinc;
Zinc-finger.
CHAIN 1..461
/note="Thyroid hormone receptor beta"
/id="PRO_0000053448"
DOMAIN 217..461
/note="NR LBD"
/evidence="ECO:0000255|PROSITE-ProRule:PRU01189"
DNA_BIND 107..181
/note="Nuclear receptor"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00407"
ZN_FING 107..127
/note="NR C4-type"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00407"
ZN_FING 145..169
/note="NR C4-type"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00407"
REGION 1..106
/note="Modulating"
REGION 244..461
/note="Interaction with NR2F6"
/evidence="ECO:0000250"
BINDING 282
/note="Thyroid hormone"
/evidence="ECO:0000250"
BINDING 320
/note="Thyroid hormone"
/evidence="ECO:0000250"
BINDING 331
/note="Thyroid hormone; via amide nitrogen"
/evidence="ECO:0000250"
BINDING 435
/note="Thyroid hormone"
/evidence="ECO:0000250"
VAR_SEQ 1..93
/note="MTPNSMTENGLPAWDKQKPRPDRGQDWKLVGMSEACLHRKSHVERRGALKNE
QTSPHLIQATWTSSIFHLDPDDVNDQSISSAQTFQTEEKKC -> MNYCMPEVHEVCPA
ASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIYMEQAWAVNQPYTCSYPGNLFKSK
DSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQK (in isoform Beta-2)"
/evidence="ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:1944303"
/id="VSP_031078"
CONFLICT 445
/note="E -> G (in Ref. 3; BAE34683)"
/evidence="ECO:0000305"
SEQUENCE 461 AA; 52630 MW; 99089194FC3E6B33 CRC64;
MTPNSMTENG LPAWDKQKPR PDRGQDWKLV GMSEACLHRK SHVERRGALK NEQTSPHLIQ
ATWTSSIFHL DPDDVNDQSI SSAQTFQTEE KKCKGYIPSY LDKDELCVVC GDKATGYHYR
CITCEGCKGF FRRTIQKSLH PSYSCKYEGK CIIDKVTRNQ CQECRFKKCI YVGMATDLVL
DDSKRLAKRK LIEENREKRR REELQKSIGH KPEPTDEEWE LIKTVTEAHV ATNAQGSHWK
QKRKFLPEDI GQAPIVNAPE GGKVDLEAFS HFTKIITPAI TRVVDFAKKL PMFCELPCED
QIILLKGCCM EIMSLRAAVR YDPDSETLTL NGEMAVTRGQ LKNGGLGVVS DAIFDLGMSL
SSFNLDDTEV ALLQAVLLMS SDRPGLACVE RIEKYQDSFL LAFEHYINYR KHHVTHFWPK
LLMKVTDLRM IGACHASRFL HMKVECPTEL FPPLFLEVFE D


Related products :

Catalog number Product name Quantity
EIAAB42233 c-erbA-2,c-erbA-beta,Erba2,Nr1a2,Nuclear receptor subfamily 1 group A member 2,Rat,Rattus norvegicus,Thrb,Thyroid hormone receptor beta
EIAAB42234 c-erbA-2,c-erbA-beta,Erba2,Mouse,Mus musculus,Nr1a2,Nuclear receptor subfamily 1 group A member 2,Thrb,Thyroid hormone receptor beta
EIAAB42232 c-erbA-2,c-erbA-beta,ERBA2,Homo sapiens,Human,NR1A2,Nuclear receptor subfamily 1 group A member 2,THR1,THRB,Thyroid hormone receptor beta
18-783-77189 RABBIT ANTI THYROID HORMONE RECEPTOR BETA 1 - Nuclear receptor subfamily 1 group A member 1; C-erbA-alpha; c-erbA-1; EAR-7; EAR7 Polyclonal 1 ml
U1927h CLIA kit c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
E1927h ELISA kit c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
E1927h ELISA c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
U1927h CLIA c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
E1927r ELISA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
E1927r ELISA c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
E1927m ELISA c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
U1927m CLIA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
U1927r CLIA c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
U1927r CLIA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
E1927m ELISA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
U1927m CLIA c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
U1927p CLIA kit c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
18-783-77191 RABBIT ANTI THYROID HORMONE RECEPTOR ALPHA 1 - TRa; Nuclear receptor subfamily 1 group A member 1; C-erbA-alpha; c-erbA-1; EAR-7; EAR7 Polyclonal 1 ml
E1927p ELISA kit c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
U1927p CLIA c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
E1927p ELISA c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
18-783-75523 RABBIT ANTI THYROID HORMONE RECEPTOR ALPHA 1 - Nuclear receptor subfamily 1 group A member 1; C-erbA-alpha; c-erbA-1; EAR-7; EAR7 Polyclonal 0.05 mg
EIAAB42231 C-ERBA-BETA,Chicken,Gallus gallus,NR1A2,Nuclear receptor subfamily 1 group A member 2,THRB,Thyroid hormone receptor beta
EIAAB27778 EAR-1R,Homo sapiens,Human,NR1D2,Nuclear receptor subfamily 1 group D member 2,Orphan nuclear hormone receptor BD73,Rev-erb-beta,V-erbA-related protein 1-related
EIAAB27776 Bos taurus,Bovine,EAR-1,NR1D1,Nuclear receptor subfamily 1 group D member 1,Rev-erbA-alpha,V-erbA-related protein 1
Pathways :
WP258: TGF-beta Receptor Signaling Pathway
WP1367: TGF-beta Receptor Signaling Pathway
WP1161: TGF-beta Receptor Signaling Pathway
WP362: TGF-beta Receptor Signaling Pathway
WP809: TGF-beta Receptor Signaling Pathway
WP1045: TGF-beta Receptor Signaling Pathway
WP566: canonical wnt - zebrafish
WP926: TGF-beta Receptor Signaling Pathway
WP474: Endochondral Ossification
WP2355: Corticotropin-releasing hormone
WP499: Fatty Acid Beta Oxidation 3
WP829: Toll-like receptor signaling pathway
WP1004: Kit Receptor Signaling Pathway
WP1225: estrogen signalling
WP215: noncanonical wnt pathway
WP39: Fatty Acid Beta Oxidation 1
WP732: Serotonin Receptor 2 and ELK-SRF/GATA4 signaling
WP949: Toll-like receptor signaling pathway
WP1112: EPO Receptor Signaling
WP1345: T Cell Receptor Signaling Pathway
WP1897: Regulation of beta-cell development
WP407: Kit Receptor Signaling Pathway
WP75: Toll-like receptor signaling pathway
WP988: Keap1-Nrf2
WP1130: T Cell Receptor Signaling Pathway

Related Genes :
[THRB ERBA2 NR1A2 THR1] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)
[THRA EAR7 ERBA1 NR1A1 THRA1 THRA2] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (V-erbA-related protein 7) (EAR-7) (c-erbA-1) (c-erbA-alpha)
[Thrb Erba2 Nr1a2] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)
[Thrb Erba2 Nr1a2] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2) (c-erbA-2) (c-erbA-beta)
[NR1D2] Nuclear receptor subfamily 1 group D member 2 (Orphan nuclear hormone receptor BD73) (Rev-erb alpha-related receptor) (RVR) (Rev-erb-beta) (V-erbA-related protein 1-related) (EAR-1R)
[Thra C-erba-alpha Nr1a1] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (c-erbA-1) (c-erbA-alpha)
[Thra C-erba-alpha Nr1a1] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (c-erbA-1) (c-erbA-alpha)
[NR1D1 EAR1 HREV THRAL] Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
[Nr1d1] Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
[NR2F6 EAR2 ERBAL2] Nuclear receptor subfamily 2 group F member 6 (V-erbA-related protein 2) (EAR-2)
[THRB C-ERBA-BETA NR1A2] Thyroid hormone receptor beta (Nuclear receptor subfamily 1 group A member 2)
[THRA NR1A1] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (c-erbA-1) (c-erbA-alpha)
[thrb nr1a2 trb si:ch211-264a6.2] Thyroid hormone receptor beta (TR-beta) (TRb) (Nuclear receptor subfamily 1 group A member 2) (Thyroid hormone receptor beta-1) (TRbeta1)
[Nr1d1 Ear1] Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
[THRA NR1A1] Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1)
[Nr2f6 Ear-2 Ear2 Erbal2] Nuclear receptor subfamily 2 group F member 6 (COUP transcription factor 3) (COUP-TF3) (V-erbA-related protein 2) (EAR-2)
[NR1D1] Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
[NR1D1] Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
[Nr2f6 Ear2 Erbal2] Nuclear receptor subfamily 2 group F member 6 (COUPg) (Ovalbumin upstream promoter gamma nuclear receptor) (V-erbA-related protein 2) (EAR-2)
[thra-b nr1a1-b thra2] Thyroid hormone receptor alpha-B (TRalphaB) (Nuclear receptor subfamily 1 group A member 1-B)
[Nr1h2 Lxrb] Oxysterols receptor LXR-beta (Liver X receptor beta) (Nuclear receptor subfamily 1 group H member 2) (Orphan nuclear receptor OR-1) (Ubiquitously-expressed nuclear receptor) (UR)
[Nr1d2] Nuclear receptor subfamily 1 group D member 2 (EAR4) (Rev-erb-beta)
[thra-a nr1a1-a thra1] Thyroid hormone receptor alpha-A (TRalphaA) (XenTR-alpha1) (Nuclear receptor subfamily 1 group A member 1-A)
[nhr-6 cnr-8 nr4a5 C48D5.1] Nuclear hormone receptor family member nhr-6 (Nuclear receptor subfamily 4 group A member 5) (Steroid hormone receptor family member cnr8)
[sex-1 cnr-14 nhr-24 nr1g1 F44A6.2] Steroid hormone receptor family member cnr14 (Nuclear receptor subfamily 1 group G member 1)
[Esrrb Err-2 Err2 Nr3b2] Steroid hormone receptor ERR2 (Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)
[P4HB ERBA2L PDI PDIA1 PO4DB] Protein disulfide-isomerase (PDI) (EC 5.3.4.1) (Cellular thyroid hormone-binding protein) (Prolyl 4-hydroxylase subunit beta) (p55)
[NR4A1 GFRP1 HMR NAK1] Nuclear receptor subfamily 4 group A member 1 (Early response protein NAK1) (Nuclear hormone receptor NUR/77) (Nur77) (Orphan nuclear receptor HMR) (Orphan nuclear receptor TR3) (ST-59) (Testicular receptor 3)
[Rxrb Nr2b2] Retinoic acid receptor RXR-beta (MHC class I regulatory element-binding protein H-2RIIBP) (Nuclear receptor subfamily 2 group B member 2) (Retinoid X receptor beta)
[ESRRB ERRB2 ESRL2 NR3B2] Steroid hormone receptor ERR2 (ERR beta-2) (Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)

Bibliography :
[32894083] Identification of a novel subgroup of endometrial cancer patients with loss of thyroid hormone receptor beta expression and improved survival.
[32804453] Thyroid Papillary Microtumor: Validation of the (Updated) Porto Proposal Assessing Sex Hormone Receptor Expression and Mutational BRAF Gene Status.
[32778631] The Role of Chest Radiograph, Procalcitonin and Moxifloxacin in Diagnosis and Management of Breast Cancer Patients with COVID-19.
[32733906] Selective Thyroid Hormone Receptor-Beta (TRβ) Agonists: New Perspectives for the Treatment of Metabolic and Neurodegenerative Disorders.
[32656810] Theoretical study on endocrine disrupting effects of polychlorinated dibenzo-p-dioxins using molecular docking simulation.
[32569302] Thyroid hormone receptor beta mutations alter photoreceptor development and function in Danio rerio (zebrafish).
[32541022] Thyroid hormone receptors mediate two distinct mechanisms of long-wavelength vision.
[32513415] Cardiac complications of thyroid hormone resistance syndromes.
[32508750] β-Arrestin 1 in Thyrotropin Receptor Signaling in Bone: Studies in Osteoblast-Like Cells.
[32416325] Somatostatin receptor profile in pituitary thyrotroph adenomas.