GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Transcription factor E2-alpha (Immunoglobulin enhancer-binding factor E12/E47) (Pancreas specific transcription factor 1c) (Transcription factor 3) (TCF-3) (Transcription regulator Pan)

 TFE2_RAT                Reviewed;         649 AA.
P21677; P21676; Q08440; Q4VY47;
01-MAY-1991, integrated into UniProtKB/Swiss-Prot.
01-MAY-1991, sequence version 1.
07-APR-2021, entry version 178.
RecName: Full=Transcription factor E2-alpha;
AltName: Full=Immunoglobulin enhancer-binding factor E12/E47;
AltName: Full=Pancreas specific transcription factor 1c;
AltName: Full=Transcription factor 3;
Short=TCF-3;
AltName: Full=Transcription regulator Pan;
Name=Tcf3; Synonyms=Pan, Ptf1c, Tcfe2a;
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS E12 AND E47), AND FUNCTION.
PubMed=2200736; DOI=10.1101/gad.4.6.1035;
Nelson C., Shen L.-P., Meister A., Fodor E., Rutter W.J.;
"Pan: a transcriptional regulator that binds chymotrypsin, insulin, and AP-
4 enhancer motifs.";
Genes Dev. 4:1035-1043(1990).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM E12).
STRAIN=Sprague-Dawley;
Wellauer P.K.;
Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [MRNA] OF 427-649 (ISOFORM E12).
PubMed=1766666;
Metz R., Ziff E.;
"The helix-loop-helix protein rE12 and the C/EBP-related factor rNFIL-6
bind to neighboring sites within the c-fos serum response element.";
Oncogene 6:2165-2178(1991).
[4]
INTERACTION WITH UBE2I.
STRAIN=CD Charles River; TISSUE=Aorta;
PubMed=9013644; DOI=10.1074/jbc.272.6.3845;
Kho C.-J., Huggins G.S., Endege W.O., Hsieh C.-M., Lee M.-E., Haber E.;
"Degradation of E2A proteins through a ubiquitin-conjugating enzyme,
UbcE2A.";
J. Biol. Chem. 272:3845-3851(1997).
[5]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=22673903; DOI=10.1038/ncomms1871;
Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C.,
Olsen J.V.;
"Quantitative maps of protein phosphorylation sites across 14 different rat
organs and tissues.";
Nat. Commun. 3:876-876(2012).
-!- FUNCTION: Transcriptional regulator involved in the initiation of
neuronal differentiation and mesenchymal to epithelial transition.
Heterodimers between TCF3 and tissue-specific basic helix-loop-helix
(bHLH) proteins play major roles in determining tissue-specific cell
fate during embryogenesis, like muscle or early B-cell differentiation.
Together with TCF15, required for the mesenchymal to epithelial
transition. Dimers bind DNA on E-box motifs: 5'-CANNTG-3' (By
similarity). Binds to the kappa-E2 site in the kappa immunoglobulin
gene enhancer (By similarity). Binds to the consensus sequence
CAC/GCTGT/C present, in the chymotrypsin, insulin, AP-4, and several
other gene enhancer motifs (PubMed:2200736).
{ECO:0000250|UniProtKB:P15806, ECO:0000250|UniProtKB:P15923,
ECO:0000269|PubMed:2200736}.
-!- SUBUNIT: Homodimer. Heterodimer; efficient DNA binding requires
dimerization with another bHLH protein. Forms a heterodimer with TWIST1
and TWIST2. Forms a heterodimer with NEUROD1; the heterodimer is
inhibited in presence of ID2, but not NR0B2, to E-box element. Forms a
heterodimer with TCF15; the heterodimer binds E-box element. Forms a
heterodimer with MYOG; heterodimerization enhances MYOG DNA-binding and
transcriptional activities. Forms a heterodimer with ATOH8; repress
transcription of TCF3 and TCF3-NEUROG3 dimer-induced transactivation of
E box-dependent promoters. Component of a nuclear TAL-1 complex
composed at least of CBFA2T3, LDB1, TAL1 and TCF3. Interacts with
NEUROD2 (By similarity). Interacts with EP300 (By similarity).
Interacts with PTF1A, TGFB1I1 (By similarity). Interacts with UBE2I
(PubMed:9013644). Interacts with BHLHA9 (By similarity).
{ECO:0000250|UniProtKB:P15806, ECO:0000250|UniProtKB:P15923,
ECO:0000269|PubMed:9013644}.
-!- SUBUNIT: [Isoform E12]: Interacts with RALGAPA1 (By similarity).
Interacts with FIGLA (By similarity). {ECO:0000250|UniProtKB:P15806,
ECO:0000250|UniProtKB:P15923}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:P15806}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=E12; Synonyms=PAN-2;
IsoId=P21677-1; Sequence=Displayed;
Name=E47; Synonyms=PAN-1;
IsoId=P21677-2; Sequence=VSP_002157;
-!- PTM: Phosphorylated following NGF stimulation.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; X54549; CAA38421.1; -; mRNA.
EMBL; X62323; CAA44199.1; -; mRNA.
EMBL; AJ973227; CAJ00426.1; -; mRNA.
EMBL; S77532; AAB21103.1; -; mRNA.
PIR; A35816; A35816.
PIR; B35816; B35816.
PIR; I78853; I78853.
RefSeq; NP_001030314.1; NM_001035237.1.
RefSeq; NP_598208.2; NM_133524.2.
SMR; P21677; -.
BioGRID; 251063; 4.
CORUM; P21677; -.
STRING; 10116.ENSRNOP00000023473; -.
iPTMnet; P21677; -.
PhosphoSitePlus; P21677; -.
PaxDb; P21677; -.
GeneID; 171046; -.
KEGG; rno:171046; -.
UCSC; RGD:620914; rat. [P21677-1]
CTD; 6929; -.
RGD; 620914; Tcf3.
eggNOG; KOG3910; Eukaryota.
InParanoid; P21677; -.
OrthoDB; 571132at2759; -.
PhylomeDB; P21677; -.
Reactome; R-RNO-525793; Myogenesis.
Reactome; R-RNO-8939236; RUNX1 regulates transcription of genes involved in differentiation of HSCs.
PRO; PR:P21677; -.
Proteomes; UP000002494; Unplaced.
GO; GO:0000785; C:chromatin; ISO:RGD.
GO; GO:0005737; C:cytoplasm; ISS:UniProtKB.
GO; GO:0005829; C:cytosol; ISO:RGD.
GO; GO:0000791; C:euchromatin; ISO:RGD.
GO; GO:0000786; C:nucleosome; ISO:RGD.
GO; GO:0005634; C:nucleus; ISS:UniProtKB.
GO; GO:0032991; C:protein-containing complex; ISS:UniProtKB.
GO; GO:0090575; C:RNA polymerase II transcription regulator complex; ISO:RGD.
GO; GO:0005667; C:transcription regulator complex; IDA:UniProtKB.
GO; GO:0043425; F:bHLH transcription factor binding; IPI:UniProtKB.
GO; GO:0003682; F:chromatin binding; ISO:RGD.
GO; GO:0000987; F:cis-regulatory region sequence-specific DNA binding; ISO:RGD.
GO; GO:0003677; F:DNA binding; ISS:UniProtKB.
GO; GO:0001228; F:DNA-binding transcription activator activity, RNA polymerase II-specific; ISS:GO_Central.
GO; GO:0003700; F:DNA-binding transcription factor activity; ISS:UniProtKB.
GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; ISS:UniProtKB.
GO; GO:0001227; F:DNA-binding transcription repressor activity, RNA polymerase II-specific; ISO:RGD.
GO; GO:0070888; F:E-box binding; ISS:UniProtKB.
GO; GO:0042802; F:identical protein binding; ISO:RGD.
GO; GO:0031435; F:mitogen-activated protein kinase kinase kinase binding; ISO:RGD.
GO; GO:0030165; F:PDZ domain binding; IPI:RGD.
GO; GO:0046982; F:protein heterodimerization activity; ISS:UniProtKB.
GO; GO:0042803; F:protein homodimerization activity; ISS:UniProtKB.
GO; GO:0070491; F:repressing transcription factor binding; ISO:RGD.
GO; GO:0001102; F:RNA polymerase II activating transcription factor binding; ISO:RGD.
GO; GO:0000978; F:RNA polymerase II cis-regulatory region sequence-specific DNA binding; ISO:RGD.
GO; GO:0043565; F:sequence-specific DNA binding; ISO:RGD.
GO; GO:0008134; F:transcription factor binding; IPI:RGD.
GO; GO:0070644; F:vitamin D response element binding; ISO:RGD.
GO; GO:0002326; P:B cell lineage commitment; ISS:UniProtKB.
GO; GO:0048468; P:cell development; ISO:RGD.
GO; GO:0007369; P:gastrulation; ISO:RGD.
GO; GO:0043966; P:histone H3 acetylation; ISO:RGD.
GO; GO:0043967; P:histone H4 acetylation; ISO:RGD.
GO; GO:0033152; P:immunoglobulin V(D)J recombination; ISO:RGD.
GO; GO:0030098; P:lymphocyte differentiation; ISO:RGD.
GO; GO:0001779; P:natural killer cell differentiation; ISO:RGD.
GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; ISO:RGD.
GO; GO:0048541; P:Peyer's patch development; ISO:RGD.
GO; GO:0030890; P:positive regulation of B cell proliferation; ISS:UniProtKB.
GO; GO:0045787; P:positive regulation of cell cycle; ISS:UniProtKB.
GO; GO:0051091; P:positive regulation of DNA-binding transcription factor activity; ISS:UniProtKB.
GO; GO:0010628; P:positive regulation of gene expression; IDA:UniProtKB.
GO; GO:0045666; P:positive regulation of neuron differentiation; ISS:UniProtKB.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; ISS:UniProtKB.
GO; GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:UniProtKB.
GO; GO:0050821; P:protein stabilization; ISO:RGD.
GO; GO:2000045; P:regulation of G1/S transition of mitotic cell cycle; ISS:UniProtKB.
GO; GO:0006357; P:regulation of transcription by RNA polymerase II; ISO:RGD.
GO; GO:0006355; P:regulation of transcription, DNA-templated; ISO:RGD.
GO; GO:0042493; P:response to drug; ISO:RGD.
GO; GO:0032496; P:response to lipopolysaccharide; ISO:RGD.
GO; GO:0033077; P:T cell differentiation in thymus; ISO:RGD.
GO; GO:0006366; P:transcription by RNA polymerase II; ISO:RGD.
Gene3D; 4.10.280.10; -; 1.
InterPro; IPR011598; bHLH_dom.
InterPro; IPR036638; HLH_DNA-bd_sf.
Pfam; PF00010; HLH; 1.
SMART; SM00353; HLH; 1.
SUPFAM; SSF47459; SSF47459; 1.
PROSITE; PS50888; BHLH; 1.
1: Evidence at protein level;
Alternative splicing; DNA-binding; Isopeptide bond; Methylation; Nucleus;
Phosphoprotein; Reference proteome; Transcription;
Transcription regulation; Ubl conjugation.
CHAIN 1..649
/note="Transcription factor E2-alpha"
/id="PRO_0000127469"
DOMAIN 544..597
/note="bHLH"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"
REGION 385..420
/note="Leucine-zipper"
MOTIF 171..177
/note="Nuclear localization signal"
/evidence="ECO:0000255"
MOD_RES 135
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P15923"
MOD_RES 140
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P15923"
MOD_RES 351
/note="Phosphothreonine"
/evidence="ECO:0000250|UniProtKB:P15806"
MOD_RES 355
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P15923"
MOD_RES 367
/note="Omega-N-methylarginine"
/evidence="ECO:0000250|UniProtKB:P15806"
MOD_RES 375
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P15923"
MOD_RES 524
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P15923"
CROSSLNK 494
/note="Glycyl lysine isopeptide (Lys-Gly) (interchain with
G-Cter in SUMO2)"
/evidence="ECO:0000250|UniProtKB:P15923"
CROSSLNK 620
/note="Glycyl lysine isopeptide (Lys-Gly) (interchain with
G-Cter in SUMO2)"
/evidence="ECO:0000250|UniProtKB:P15923"
VAR_SEQ 525..596
/note="PDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLS
TEKPQTKLLILHQAVAVILS -> STDEVLSLEEKDLRDRERRMANNARERVRVRDINE
AFRELGRMCQLHLKSDKAQTKLLILQQAVQVILG (in isoform E47)"
/evidence="ECO:0000303|PubMed:2200736"
/id="VSP_002157"
CONFLICT 167
/note="L -> LA (in Ref. 1; CAA44199)"
/evidence="ECO:0000305"
CONFLICT 427
/note="P -> A (in Ref. 3; AAB21103)"
/evidence="ECO:0000305"
CONFLICT 508
/note="D -> DH (in Ref. 3; AAB21103)"
/evidence="ECO:0000305"
CONFLICT 576..577
/note="ST -> NS (in Ref. 3; AAB21103)"
/evidence="ECO:0000305"
CONFLICT 637
/note="P -> T (in Ref. 3; AAB21103)"
/evidence="ECO:0000305"
MOD_RES P21677-2:526
/note="Phosphothreonine"
/evidence="ECO:0000250"
SEQUENCE 649 AA; 67655 MW; 882F19EDB47D14EA CRC64;
MMNQSQRMAP VGSDKELSDL LDFSMMFPLP VANGKGRPAS LAGTQFAGSG LEDRPSSESW
GNSEQNSSSF DPSRAYSEGA HFSDSHSSLP PSTFLGAGLG GKGSERNAYA TFGRDTSVGT
LSQAGFLPGE LGLSSPGPLS PSGVKSSSQY YTSFPSNPRR RAADGGLDTQ PKKVRKVPPG
LPSSVYPSSS GDNYSRDATA YPSAKTPSSA YPSPFYVADG SLHPSAELWS PPGQVGFGPM
LGDGSAPLPL APGSSSVSSG AFGGLQQQDR MGYQLHGSEV NGTLPAVSSF SAAPGTYSGT
SGHTPPVSGA DSLLGTRGTT ASSSGDALGK ALASIYSPDH SSNNFSPSPS TPVGSPQGLP
GTSQWPRAGA PSALSPNYDA GLHGLSKMED RLDEAIHVLR SHAVGTASEL HGLLPGHSTL
TTSFAGPMSL GGRHAGLVSG SHPEDGLTSG ASLLHNHASL PSQPSSLPDL SQRPPDSFSG
LGRAGVTAGA SEIKREEKED EEVTSVADAE EDKKDLKVPR TRTSPDEDED DLLPPEQKAE
REKERRVANN ARERLRVRDI NEAFKELGRM CQLHLSTEKP QTKLLILHQA VAVILSLEQQ
VRERNLNPKA ACLKRREEEK VSGVVGDPQL ALSAAHPGLG EAHNPAGHL


Related products :

Catalog number Product name Quantity
EIAAB42103 Immunoglobulin enhancer-binding factor E12_E47,Pan,Pancreas specific transcription factor 1c,Ptf1c,Rat,Rattus norvegicus,Tcf3,TCF-3,Tcfe2a,Transcription factor 3,Transcription factor E2-alpha,Transcri
EIAAB42104 Alf2,Immunoglobulin enhancer-binding factor E12_E47,Me2,Mouse,Mus musculus,Tcf3,TCF-3,Tcfe2a,Transcription factor 3,Transcription factor A1,Transcription factor E2-alpha
18-003-44075 Transcription factor E2-alpha - Immunoglobulin enhancer-binding factor E12_E47; Transcription factor 3; TCF-3; Immunoglobulin transcription factor 1; Transcription factor ITF-1; Kappa-E2-binding facto 0.1 mg Protein A
EIAAB32964 bHLH transcription factor p48,Mouse,Mus musculus,p48 DNA-binding subunit of transcription factor PTF1,Pancreas transcription factor 1 subunit alpha,Pancreas-specific transcription factor 1a,Ptf1a,Ptf1
EIAAB32963 bHLH transcription factor p48,p48 DNA-binding subunit of transcription factor PTF1,Pancreas transcription factor 1 subunit alpha,Pancreas-specific transcription factor 1a,Ptf1a,Ptf1p48,PTF1-p48,Rat,Ra
18-003-42089 Pancreas transcription factor 1 subunit alpha - Pancreas-specific transcription factor 1a; bHLH transcription factor p48; p48 DNA-binding subunit of transcription factor PTF1; PTF1-p48 Polyclonal 0.1 mg Protein A
31-248 Transcription initiation factor IIA . and . chains (GTranscription Factor Antibodies2A1, Transcription Factor AntibodiesIIA p35 and p19 subunits, Transcription Factor AntibodiesIIAL) binding ability o 0.05 mg
EIAAB36445 Cbfa1,CBF-alpha-1,Core-binding factor subunit alpha-1,Osf2,OSF-2,Osteoblast-specific transcription factor 2,Rat,Rattus norvegicus,Runt-related transcription factor 2,Runx2
18-272-195373 TCF3 ( phospho T355 ) - Rabbit polyclonal to TCF3 ( phospho T355 ); Immunoglobulin enhancer-binding factor E12_E47; Transcription factor 3; TCF-3; Immunoglobulin transcription factor 1; Transcription 0.05 mg
EIAAB42096 Alpha-globin transcription factor CP2,Homo sapiens,Human,LSF,SAA3 enhancer factor,SEF,TFCP2,Transcription factor LSF
EIAAB47163 CREB_ATF bZIP transcription factor,Crebzf,HCF-binding transcription factor Zhangfei,Host cell factor-binding transcription factor Zhangfei,Mouse,Mus musculus,Tyrosine kinase-associated leucine zipper
18-003-43070 T-box transcription factor TBX21 - T-box protein 21; Transcription factor TBLYM; T-cell-specific T-box transcription factor T-bet Polyclonal 0.1 mg Protein A
EIAAB27823 Alpha-1-fetoprotein transcription factor,B1-binding factor,B1F,CPF,CYP7A promoter-binding factor,FTF,hB1F,Hepatocytic transcription factor,Homo sapiens,Human,Liver receptor homolog 1,LRH-1,NR5A2,Nucle
EIAAB42084 Homo sapiens,Human,Mitochondrial transcription factor 1,MtTF1,mtTFA,TCF6,TCF-6,TCF6L2,TFAM,Transcription factor 6,Transcription factor 6-like 2,Transcription factor A, mitochondrial
EIAAB25650 Homo sapiens,Human,Metal regulatory transcription factor 1,MRE-binding transcription factor,MTF1,Transcription factor MTF-1
18-003-42098 Ets domain transcription factor - ESE3 transcription factor; EHF protein; DJ875K15.1.2 (Ets homologous factor (Ets-domain transcription factor. ESE-3B (Isoform 2))); ETS-family transcription factor EH 0.1 mg Protein A
EIAAB42078 HMG box transcription factor 4,Homo sapiens,hTCF-4,Human,T-cell factor 4,T-cell-specific transcription factor 4,TCF4,TCF-4,TCF7L2,Transcription factor 7-like 2
EIAAB32965 bHLH transcription factor p48,bHLHa29,BHLHA29,Class A basic helix-loop-helix protein 29,Homo sapiens,Human,p48 DNA-binding subunit of transcription factor PTF1,Pancreas transcription factor 1 subunit
EIAAB47164 CREB_ATF bZIP transcription factor,CREBZF,HCF-binding transcription factor Zhangfei,Homo sapiens,Host cell factor-binding transcription factor Zhangfei,Human,ZF
18-003-42234 POU domain. class 2. transcription factor 3 - Octamer-binding transcription factor 11; Oct-11; Transcription factor Skn-1; PLA-1 protein Polyclonal 0.1 mg Protein A
18-003-42234 POU domain. class 2. transcription factor 3 - Octamer-binding transcription factor 11; Oct-11; Transcription factor Skn-1; PLA-1 protein Polyclonal 0.05 mg Aff Pur
18-003-42235 POU domain. class 2. transcription factor 3 - Octamer-binding transcription factor 11; Oct-11; Transcription factor Skn-1; PLA-1 protein Polyclonal 0.05 mg Aff Pur
EIAAB25651 Metal regulatory transcription factor 1,Mouse,MRE-binding transcription factor,Mtf1,Mtf-1,Mus musculus,Transcription factor MTF-1
18-003-42235 POU domain. class 2. transcription factor 3 - Octamer-binding transcription factor 11; Oct-11; Transcription factor Skn-1; PLA-1 protein Polyclonal 0.1 mg Protein A
EIAAB42079 HMG box transcription factor 4,Mouse,mTCF-4,Mus musculus,T-cell factor 4,T-cell-specific transcription factor 4,Tcf4,TCF-4,Tcf7l2,Transcription factor 7-like 2
Pathways :
WP1789: Binding of RNA by Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs)
WP1899: Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs)
WP1541: Energy Metabolism
WP927: Signaling of Hepatocyte Growth Factor Receptor
WP1066: Eukaryotic Transcription Initiation
WP1905: RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription
WP491: Eukaryotic Transcription Initiation
WP948: Eukaryotic Transcription Initiation
WP272: Blood Clotting Cascade
WP1930: Transcription
WP1235: Signaling of Hepatocyte Growth Factor Receptor
WP177: Eukaryotic Transcription Initiation
WP313: Signaling of Hepatocyte Growth Factor Receptor
WP1822: Generic Transcription Pathway
WP344: Eukaryotic Transcription Initiation
WP810: Signaling of Hepatocyte Growth Factor Receptor
WP425: Eukaryotic Transcription Initiation
WP1162: Signaling of Hepatocyte Growth Factor Receptor
WP94: Signaling of Hepatocyte Growth Factor Receptor
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP193: Signaling of Hepatocyte Growth Factor Receptor
WP1983: Splicing factor NOVA regulated synpatic proteins
WP2148: Brain derived neurotrophic factor
WP830: Eukaryotic Transcription Initiation
WP1046: Signaling of Hepatocyte Growth Factor Receptor

Related Genes :
[Tcf3 Pan Ptf1c Tcfe2a] Transcription factor E2-alpha (Immunoglobulin enhancer-binding factor E12/E47) (Pancreas specific transcription factor 1c) (Transcription factor 3) (TCF-3) (Transcription regulator Pan)
[TCF3 PAN] Transcription factor E2-alpha (Immunoglobulin-enhancer-binding factor E12/E47) (Transcription factor 3) (TCF-3) (Transcription regulator Pan)
[TCF3 BHLHB21 E2A ITF1] Transcription factor E2-alpha (Class B basic helix-loop-helix protein 21) (bHLHb21) (Immunoglobulin enhancer-binding factor E12/E47) (Immunoglobulin transcription factor 1) (Kappa-E2-binding factor) (Transcription factor 3) (TCF-3) (Transcription factor ITF-1)
[Tcf3 Alf2 Me2 Tcfe2a] Transcription factor E2-alpha (Immunoglobulin enhancer-binding factor E12/E47) (Transcription factor 3) (TCF-3) (Transcription factor A1)
[TCF4 BHLHB19 ITF2 SEF2] Transcription factor 4 (TCF-4) (Class B basic helix-loop-helix protein 19) (bHLHb19) (Immunoglobulin transcription factor 2) (ITF-2) (SL3-3 enhancer factor 2) (SEF-2)
[Tcf4 Itf2 Sef2] Transcription factor 4 (TCF-4) (Immunoglobulin transcription factor 2) (ITF-2) (RITF-2) (R8f DNA-binding protein) (SL3-3 enhancer factor 2) (SEF-2)
[nef] Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein]
[PTF1A BHLHA29 PTF1P48] Pancreas transcription factor 1 subunit alpha (Class A basic helix-loop-helix protein 29) (bHLHa29) (Pancreas-specific transcription factor 1a) (bHLH transcription factor p48) (p48 DNA-binding subunit of transcription factor PTF1) (PTF1-p48)
[Ptf1a Ptf1p48] Pancreas transcription factor 1 subunit alpha (Pancreas-specific transcription factor 1a) (bHLH transcription factor p48) (p48 DNA-binding subunit of transcription factor PTF1) (PTF1-p48)
[Ptf1a Ptf1p48] Pancreas transcription factor 1 subunit alpha (Pancreas-specific transcription factor 1a) (bHLH transcription factor p48) (p48 DNA-binding subunit of transcription factor PTF1) (PTF1-p48)
[LEF1] Lymphoid enhancer-binding factor 1 (LEF-1) (T cell-specific transcription factor 1-alpha) (TCF1-alpha)
[Tcf12 Alf1 Meb] Transcription factor 12 (TCF-12) (Class A helix-loop-helix transcription factor ME1) (DNA-binding protein HTF4) (E-box-binding protein) (Transcription factor HTF-4)
[ZFHX3 ATBF1 C16orf47] Zinc finger homeobox protein 3 (AT motif-binding factor 1) (AT-binding transcription factor 1) (Alpha-fetoprotein enhancer-binding protein) (Zinc finger homeodomain protein 3) (ZFH-3)
[RUNX1 AML1 CBFA2] Runt-related transcription factor 1 (Acute myeloid leukemia 1 protein) (Core-binding factor subunit alpha-2) (CBF-alpha-2) (Oncogene AML-1) (Polyomavirus enhancer-binding protein 2 alpha B subunit) (PEA2-alpha B) (PEBP2-alpha B) (SL3-3 enhancer factor 1 alpha B subunit) (SL3/AKV core-binding factor alpha B subunit)
[NFE2L1 HBZ17 NRF1 TCF11] Endoplasmic reticulum membrane sensor NFE2L1 (Locus control region-factor 1) (LCR-F1) (Nuclear factor erythroid 2-related factor 1) (NF-E2-related factor 1) (NFE2-related factor 1) (Nuclear factor, erythroid derived 2, like 1) (Protein NRF1, p120 form) (Transcription factor 11) (TCF-11) [Cleaved into: Transcription factor NRF1 (Protein NRF1, p110 form)]
[Tcf12] Transcription factor 12 (TCF-12) (DNA-binding protein HTF4) (E-box-binding protein) (Salivary-specific cAMP response element-binding protein alpha) (SCBP-alpha) (Transcription factor HTF-4)
[tat] Protein Tat (Transactivating regulatory protein)
[RUNX2 AML3 CBFA1 OSF2 PEBP2A] Runt-related transcription factor 2 (Acute myeloid leukemia 3 protein) (Core-binding factor subunit alpha-1) (CBF-alpha-1) (Oncogene AML-3) (Osteoblast-specific transcription factor 2) (OSF-2) (Polyomavirus enhancer-binding protein 2 alpha A subunit) (PEA2-alpha A) (PEBP2-alpha A) (SL3-3 enhancer factor 1 alpha A subunit) (SL3/AKV core-binding factor alpha A subunit)
[HNF1A TCF1] Hepatocyte nuclear factor 1-alpha (HNF-1-alpha) (HNF-1A) (Liver-specific transcription factor LF-B1) (LFB1) (Transcription factor 1) (TCF-1)
[TCF7L2 TCF4] Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)
[CEBPB TCF5 PP9092] CCAAT/enhancer-binding protein beta (C/EBP beta) (Liver activator protein) (LAP) (Liver-enriched inhibitory protein) (LIP) (Nuclear factor NF-IL6) (Transcription factor 5) (TCF-5)
[Runx1 Aml1 Cbfa2 Pebp2ab] Runt-related transcription factor 1 (Acute myeloid leukemia 1 protein) (Core-binding factor subunit alpha-2) (CBF-alpha-2) (Oncogene AML-1) (Polyomavirus enhancer-binding protein 2 alpha B subunit) (PEA2-alpha B) (PEBP2-alpha B) (SL3-3 enhancer factor 1 alpha B subunit) (SL3/AKV core-binding factor alpha B subunit)
[TCF12 BHLHB20 HEB HTF4] Transcription factor 12 (TCF-12) (Class B basic helix-loop-helix protein 20) (bHLHb20) (DNA-binding protein HTF4) (E-box-binding protein) (Transcription factor HTF-4)
[RUNX3 AML2 CBFA3 PEBP2A3] Runt-related transcription factor 3 (Acute myeloid leukemia 2 protein) (Core-binding factor subunit alpha-3) (CBF-alpha-3) (Oncogene AML-2) (Polyomavirus enhancer-binding protein 2 alpha C subunit) (PEA2-alpha C) (PEBP2-alpha C) (SL3-3 enhancer factor 1 alpha C subunit) (SL3/AKV core-binding factor alpha C subunit)
[Tcf7l2 Tcf4] Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (mTCF-4)
[FOXA1 HNF3A TCF3A] Hepatocyte nuclear factor 3-alpha (HNF-3-alpha) (HNF-3A) (Forkhead box protein A1) (Transcription factor 3A) (TCF-3A)
[tcf3 e2a] Transcription factor E2-alpha (Transcription factor 3) (TCF-3) (Transcription factor XE12/XE47)
[ZEB1 AREB6 TCF8] Zinc finger E-box-binding homeobox 1 (NIL-2-A zinc finger protein) (Negative regulator of IL2) (Transcription factor 8) (TCF-8)
[TFCP2 LSF SEF] Alpha-globin transcription factor CP2 (SAA3 enhancer factor) (Transcription factor LSF)
[ATF4 CREB2 TXREB] Cyclic AMP-dependent transcription factor ATF-4 (cAMP-dependent transcription factor ATF-4) (Activating transcription factor 4) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (Tax-responsive enhancer element-binding protein 67) (TaxREB67)

Bibliography :