GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Transcription factor SPT20 homolog (p38-interacting protein) (p38IP)

 SP20H_HUMAN             Reviewed;         779 AA.
Q8NEM7; E7ER46; Q71RF3; Q9Y6A6;
19-JUL-2005, integrated into UniProtKB/Swiss-Prot.
31-MAY-2011, sequence version 2.
17-JUN-2020, entry version 140.
RecName: Full=Transcription factor SPT20 homolog;
AltName: Full=p38-interacting protein;
Short=p38IP;
Name=SUPT20H; Synonyms=C13orf19, FAM48A; ORFNames=FP757;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND TISSUE SPECIFICITY.
TISSUE=Prostate, and Testis;
PubMed=11340631; DOI=10.1002/pros.1051;
Schmidt U., Fiedler U., Pilarsky C.P., Ehlers W., Fuessel S., Haase M.,
Faller G., Sauter G., Wirth M.P.;
"Identification of a novel gene on chromosome 13 between BRCA2 and Rb1.";
Prostate 47:91-101(2001).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND INTERACTION WITH MAPK14.
PubMed=16751104; DOI=10.1016/j.cell.2006.03.048;
Zohn I.E., Li Y., Skolnik E.Y., Anderson K.V., Han J., Niswander L.;
"p38 and a p38-interacting protein are critical for downregulation of E-
cadherin during mouse gastrulation.";
Cell 125:957-969(2006).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Kidney;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057823; DOI=10.1038/nature02379;
Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L.,
Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S.,
Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P.,
Ambrose K.D., Andrews D.T., Ashwell R.I.S., Babbage A.K., Bagguley C.L.,
Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P.,
Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P.,
Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C.,
Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P.,
Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L.,
Frankish A.G., Frankland J., French L., Garner P., Garnett J.,
Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M.,
Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D.,
Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D.,
Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S.,
Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J.,
Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S.,
Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S.,
Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R.,
Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W.,
Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P.,
Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L.,
Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R.,
Rogers J., Ross M.T.;
"The DNA sequence and analysis of human chromosome 13.";
Nature 428:522-528(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 445-779, AND VARIANT MET-773.
PubMed=15498874; DOI=10.1073/pnas.0404089101;
Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X.,
Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.,
Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.;
"Large-scale cDNA transfection screening for genes related to cancer
development and progression.";
Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004).
[7]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-519, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
[8]
FUNCTION, INTERACTION WITH ATG9A, AND SUBCELLULAR LOCATION.
PubMed=19893488; DOI=10.1038/emboj.2009.321;
Webber J.L., Tooze S.A.;
"Coordinated regulation of autophagy by p38alpha MAPK through mAtg9 and
p38IP.";
EMBO J. 29:27-40(2010).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=22814378; DOI=10.1073/pnas.1210303109;
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A.,
Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E.,
Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.;
"N-terminal acetylome analyses and functional insights of the N-terminal
acetyltransferase NatB.";
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012).
[10]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-494, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
-!- FUNCTION: Required for MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or
MAPK14) activation during gastrulation. Required for down-regulation of
E-cadherin during gastrulation by regulating E-cadherin protein level
downstream from NCK-interacting kinase (NIK) and independently of the
regulation of transcription by FGF signaling and Snail (By similarity).
Required for starvation-induced ATG9A trafficking during autophagy.
{ECO:0000250, ECO:0000269|PubMed:19893488}.
-!- SUBUNIT: Interacts with MAPK14. Interacts with ATG9A.
{ECO:0000269|PubMed:16751104, ECO:0000269|PubMed:19893488}.
-!- INTERACTION:
Q8NEM7; Q16539: MAPK14; NbExp=5; IntAct=EBI-946984, EBI-73946;
Q8NEM7-2; Q7Z3C6: ATG9A; NbExp=8; IntAct=EBI-7568679, EBI-727146;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:19893488}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q8NEM7-1; Sequence=Displayed;
Name=2;
IsoId=Q8NEM7-2; Sequence=VSP_014877, VSP_014878, VSP_014879;
Name=3;
IsoId=Q8NEM7-3; Sequence=VSP_055621, VSP_014878, VSP_014879;
-!- TISSUE SPECIFICITY: Highly expressed in testis, moderately in brain and
pituitary gland. Expressed in several fetal tissues, including lung,
brain, thymus and kidney. Expression is down-regulated in malignant
prostate tissues. {ECO:0000269|PubMed:11340631}.
-!- SIMILARITY: Belongs to the SPT20 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAQ15220.1; Type=Frameshift; Evidence={ECO:0000305};
Sequence=AAQ15220.1; Type=Miscellaneous discrepancy; Note=Intron retention.; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AJ130894; CAB62207.1; -; mRNA.
EMBL; AF093250; AAD40550.1; -; mRNA.
EMBL; AK225376; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AL138706; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL391383; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC030686; AAH30686.1; -; mRNA.
EMBL; AF370384; AAQ15220.1; ALT_SEQ; mRNA.
CCDS; CCDS31959.1; -. [Q8NEM7-1]
CCDS; CCDS61311.1; -. [Q8NEM7-3]
CCDS; CCDS9362.1; -. [Q8NEM7-2]
RefSeq; NP_001014308.2; NM_001014286.2. [Q8NEM7-1]
RefSeq; NP_001265409.1; NM_001278480.1. [Q8NEM7-3]
RefSeq; NP_001265410.1; NM_001278481.1. [Q8NEM7-2]
RefSeq; NP_001265411.1; NM_001278482.1. [Q8NEM7-2]
RefSeq; NP_060039.1; NM_017569.3. [Q8NEM7-2]
BioGRID; 120729; 38.
ComplexPortal; CPX-900; SAGA complex.
CORUM; Q8NEM7; -.
IntAct; Q8NEM7; 23.
iPTMnet; Q8NEM7; -.
PhosphoSitePlus; Q8NEM7; -.
BioMuta; SUPT20H; -.
DMDM; 334302791; -.
EPD; Q8NEM7; -.
jPOST; Q8NEM7; -.
MassIVE; Q8NEM7; -.
MaxQB; Q8NEM7; -.
PaxDb; Q8NEM7; -.
PeptideAtlas; Q8NEM7; -.
PRIDE; Q8NEM7; -.
ProteomicsDB; 17715; -.
ProteomicsDB; 73182; -. [Q8NEM7-1]
ProteomicsDB; 73183; -. [Q8NEM7-2]
Antibodypedia; 49228; 74 antibodies.
DNASU; 55578; -.
Ensembl; ENST00000350612; ENSP00000218894; ENSG00000102710. [Q8NEM7-1]
Ensembl; ENST00000356185; ENSP00000348512; ENSG00000102710. [Q8NEM7-2]
Ensembl; ENST00000360252; ENSP00000353388; ENSG00000102710. [Q8NEM7-2]
Ensembl; ENST00000464744; ENSP00000419754; ENSG00000102710. [Q8NEM7-2]
Ensembl; ENST00000475892; ENSP00000417510; ENSG00000102710. [Q8NEM7-3]
GeneID; 55578; -.
KEGG; hsa:55578; -.
UCSC; uc001uwg.4; human. [Q8NEM7-1]
CTD; 55578; -.
DisGeNET; 55578; -.
EuPathDB; HostDB:ENSG00000102710.19; -.
GeneCards; SUPT20H; -.
HGNC; HGNC:20596; SUPT20H.
HPA; ENSG00000102710; Low tissue specificity.
MIM; 613417; gene.
neXtProt; NX_Q8NEM7; -.
OpenTargets; ENSG00000102710; -.
PharmGKB; PA134985241; -.
eggNOG; ENOG410IJ9A; Eukaryota.
eggNOG; ENOG410YRYS; LUCA.
GeneTree; ENSGT00390000013549; -.
HOGENOM; CLU_020200_1_0_1; -.
InParanoid; Q8NEM7; -.
KO; K21245; -.
OMA; EDYVFEC; -.
OrthoDB; 369747at2759; -.
TreeFam; TF329155; -.
Reactome; R-HSA-3214847; HATs acetylate histones.
BioGRID-ORCS; 55578; 82 hits in 792 CRISPR screens.
ChiTaRS; SUPT20H; human.
GeneWiki; FAM48A; -.
GenomeRNAi; 55578; -.
Pharos; Q8NEM7; Tbio.
PRO; PR:Q8NEM7; -.
Proteomes; UP000005640; Chromosome 13.
RNAct; Q8NEM7; protein.
Bgee; ENSG00000102710; Expressed in kidney and 225 other tissues.
ExpressionAtlas; Q8NEM7; baseline and differential.
Genevisible; Q8NEM7; HS.
GO; GO:0000124; C:SAGA complex; IBA:GO_Central.
GO; GO:0070461; C:SAGA-type complex; IDA:BHF-UCL.
GO; GO:0003712; F:transcription coregulator activity; IEA:InterPro.
GO; GO:0006914; P:autophagy; IEA:UniProtKB-KW.
GO; GO:0007369; P:gastrulation; IEA:UniProtKB-KW.
GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IBA:GO_Central.
InterPro; IPR021950; Spt20.
PANTHER; PTHR13526; PTHR13526; 2.
Pfam; PF12090; Spt20; 2.
1: Evidence at protein level;
Alternative splicing; Autophagy; Developmental protein; Gastrulation;
Nucleus; Phosphoprotein; Polymorphism; Reference proteome.
CHAIN 1..779
/note="Transcription factor SPT20 homolog"
/id="PRO_0000187039"
COMPBIAS 636..754
/note="Gln-rich"
MOD_RES 296
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q7TT00"
MOD_RES 494
/note="Phosphothreonine"
/evidence="ECO:0000244|PubMed:23186163"
MOD_RES 519
/note="Phosphoserine"
/evidence="ECO:0000244|PubMed:19690332"
MOD_RES 524
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q7TT00"
VAR_SEQ 55
/note="K -> KQ (in isoform 2)"
/evidence="ECO:0000303|PubMed:11340631,
ECO:0000303|PubMed:16751104"
/id="VSP_014877"
VAR_SEQ 531
/note="R -> RSGTPKPSTPTPTPSSTPHPPDAQSSTPSTPSATPTPQDSGFTPQPT
LLTQFAQQQRSLSQAMPVTTIPLSTMVTSITPG (in isoform 3)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_055621"
VAR_SEQ 700..732
/note="VLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQ -> AVAILAASNGYGSSS
STNSSATSSSAYRQPVKK (in isoform 2 and isoform 3)"
/evidence="ECO:0000303|PubMed:11340631,
ECO:0000303|PubMed:14702039, ECO:0000303|PubMed:16751104"
/id="VSP_014878"
VAR_SEQ 733..779
/note="Missing (in isoform 2 and isoform 3)"
/evidence="ECO:0000303|PubMed:11340631,
ECO:0000303|PubMed:14702039, ECO:0000303|PubMed:16751104"
/id="VSP_014879"
VARIANT 154
/note="M -> V (in dbSNP:rs7324275)"
/id="VAR_055798"
VARIANT 773
/note="T -> M (in dbSNP:rs9469)"
/evidence="ECO:0000269|PubMed:15498874"
/id="VAR_055799"
CONFLICT 707
/note="A -> V (in Ref. 5; AAH30686)"
/evidence="ECO:0000305"
SEQUENCE 779 AA; 85789 MW; 4CD7DFD8719F621C CRC64;
MQQALELALD RAEYVIESAR QRPPKRKYLS SGRKSVFQKL YDLYIEECEK EPEVKKLRRN
VNLLEKLVMQ ETLSCLVVNL YPGNEGYSLM LRGKNGSDSE TIRLPYEEGE LLEYLDAEEL
PPILVDLLEK SQVNIFHCGC VIAEIRDYRQ SSNMKSPGYQ SRHILLRPTM QTLICDVHSI
TSDNHKWTQE DKLLLESQLI LATAEPLCLD PSIAVTCTAN RLLYNKQKMN TRPMKRCFKR
YSRSSLNRQQ DLSHCPPPPQ LRLLDFLQKR KERKAGQHYD LKISKAGNCV DMWKRSPCNL
AIPSEVDVEK YAKVEKSIKS DDSQPTVWPA HDVKDDYVFE CEAGTQYQKT KLTILQSLGD
PLYYGKIQPC KADEESDSQM SPSHSSTDDH SNWFIIGSKT DAERVVNQYQ ELVQNEAKCP
VKMSHSSSGS ASLSQVSPGK ETDQTETVSV QSSVLGKGVK HRPPPIKLPS SSGNSSSGNY
FTPQQTSSFL KSPTPPPSSK PSSIPRKSSV DLNQVSMLSP AALSPASSSQ RTTATQVMAN
SAGLNFINVV GSVCGAQALM SGSNPMLGCN TGAITPAGIN LSGLLPSGGL LPNALPSAMQ
AASQAGVPFG LKNTSSLRPL NLLQLPGGSL IFNTLQQQQQ QLSQFTPQQP QQPTTCSPQQ
PGEQGSEQGS TSQEQALSAQ QAAVINLTGV GSFMQSQAAV LSQLGSAENR PEQSLPQQRF
QLSSAFQQQQ QQIQQLRFLQ HQMAMAAAAA QTAQLHHHRH TGSQSKSKMK RGTPTTPKF


Related products :

Catalog number Product name Quantity
SP20H_MOUSE Mouse ELISA Kit FOR Transcription factor SPT20 homolog 96T
E0838c Human ELISA Kit FOR Putative transcription factor SPT20 homolog-like 2 96T
EIAAB10631 Dcp1a,MAD homolog 4-interacting transcription coactivator 1,Mitc1,Mouse,mRNA-decapping enzyme 1A,Mus musculus,Smad4-interacting transcriptional co-activator,Smif,Transcription factor SMIF
EIAAB39347 Mouse,Mus musculus,Spata24,Spermatogenesis-associated protein 24,TATA-binding protein-like factor-interacting protein,Testis protein T6441 homolog,Tipt,Tipt2,TLF-interacting protein,TRF2-interacting p
EIAAB41848 Bos taurus,Bovine,RAP1,RAP1 homolog,Repressor_activator protein 1 homolog,Telomeric repeat-binding factor 2-interacting protein 1,TERF2-interacting telomeric protein 1,TERF2IP,TRF2-interacting telomer
EIAAB41846 Rap1,RAP1 homolog,Rat,Rattus norvegicus,Repressor_activator protein 1 homolog,Telomeric repeat-binding factor 2-interacting protein 1,TERF2-interacting telomeric protein 1,Terf2ip,TRF2-interacting tel
EIAAB41849 Dopamine receptor-interacting protein 5,DRIP5,Homo sapiens,hRap1,Human,PP8000,RAP1,RAP1 homolog,Repressor_activator protein 1 homolog,Telomeric repeat-binding factor 2-interacting protein 1,TERF2-inte
E1313b ELISA kit Bos taurus,Bovine,HBV X-interacting protein homolog,HBX-interacting protein homolog,HBXIP,Hepatitis B virus X-interacting protein homolog 96T
E1313m ELISA kit HBV X-interacting protein homolog,HBX-interacting protein homolog,Hbxip,Hepatitis B virus X-interacting protein homolog,Mouse,Mus musculus,Xip 96T
E1313b ELISA Bos taurus,Bovine,HBV X-interacting protein homolog,HBX-interacting protein homolog,HBXIP,Hepatitis B virus X-interacting protein homolog 96T
U1313b CLIA Bos taurus,Bovine,HBV X-interacting protein homolog,HBX-interacting protein homolog,HBXIP,Hepatitis B virus X-interacting protein homolog 96T
U1313m CLIA HBV X-interacting protein homolog,HBX-interacting protein homolog,Hbxip,Hepatitis B virus X-interacting protein homolog,Mouse,Mus musculus,Xip 96T
E1313m ELISA HBV X-interacting protein homolog,HBX-interacting protein homolog,Hbxip,Hepatitis B virus X-interacting protein homolog,Mouse,Mus musculus,Xip 96T
EIAAB14123 C13orf19,FAM48A,FP757,Homo sapiens,Human,p38-interacting protein,p38IP,Protein FAM48A
EIAAB14121 D3Ertd300e,Fam48a,Mouse,Mus musculus,p38-interacting protein,p38IP,Protein FAM48A
U1313p CLIA HBV X-interacting protein homolog,HBX-interacting protein homolog,HBXIP,Hepatitis B virus X-interacting protein homolog,Pig,Sus scrofa 96T
E1313p ELISA kit HBV X-interacting protein homolog,HBX-interacting protein homolog,HBXIP,Hepatitis B virus X-interacting protein homolog,Pig,Sus scrofa 96T
E1313p ELISA HBV X-interacting protein homolog,HBX-interacting protein homolog,HBXIP,Hepatitis B virus X-interacting protein homolog,Pig,Sus scrofa 96T
EIAAB29997 Hematopoietic PBX-interacting protein,Hpip,Mouse,Mus musculus,Pbxip1,Pre-B-cell leukemia transcription factor-interacting protein 1
EIAAB29996 Hematopoietic PBX-interacting protein,Hpip,Pbxip1,Pre-B-cell leukemia transcription factor-interacting protein 1,Rat,Rattus norvegicus
EIAAB29999 Bos taurus,Bovine,Hematopoietic PBX-interacting protein,HPIP,PBXIP1,Pre-B-cell leukemia transcription factor-interacting protein 1
EIAAB29998 Hematopoietic PBX-interacting protein,Homo sapiens,HPIP,Human,PBXIP1,Pre-B-cell leukemia transcription factor-interacting protein 1
EIAAB41847 Chicken,cRAP1,Gallus gallus,RAP1,RAP1 homolog,Repressor_activator protein 1 homolog,Telomeric repeat-binding factor 2-interacting protein 1,TERF2-interacting telomeric protein 1,TERF2IP,TRF2-interacti
EIAAB41850 MNCb-0448,MNCb-0628,Mouse,Mus musculus,Rap1,RAP1 homolog,Repressor_activator protein 1 homolog,Telomeric repeat-binding factor 2-interacting protein 1,TERF2-interacting telomeric protein 1,Terf2ip,TRF
EIAAB45451 bHLHb12,BHLHB12,Class B basic helix-loop-helix protein 12,FIP,FOS-interacting protein,Homo sapiens,Human,Major late transcription factor 2,Upstream stimulatory factor 2,Upstream transcription factor 2
Pathways :
WP1905: RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription
WP525: Mitochondrial Unfolded-Protein Response
WP1046: Signaling of Hepatocyte Growth Factor Receptor
WP1678: Nucleotide excision repair
WP232: G Protein Signaling Pathways
WP1613: 1,4-Dichlorobenzene degradation
WP2341: vitamin B1 (thiamin) biosynthesis and salvage pathway
WP1625: Base excision repair
WP193: Signaling of Hepatocyte Growth Factor Receptor
WP731: Sterol regulatory element binding protein related
WP1162: Signaling of Hepatocyte Growth Factor Receptor
WP1690: Propanoate metabolism
WP830: Eukaryotic Transcription Initiation
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP1694: Pyrimidine metabolism
WP313: Signaling of Hepatocyte Growth Factor Receptor
WP1654: gamma-Hexachlorocyclohexane degradation
WP1983: Splicing factor NOVA regulated synpatic proteins
WP1661: Glyoxylate and dicarboxylate metabolism
WP211: BMP signaling pathway
WP94: Signaling of Hepatocyte Growth Factor Receptor
WP1371: G Protein Signaling Pathways
WP1714: Tyrosine metabolism
WP346: Protein Modifications
WP1502: Mitochondrial biogenesis

Related Genes :
[SUPT20H C13orf19 FAM48A FP757] Transcription factor SPT20 homolog (p38-interacting protein) (p38IP)
[Supt20h D3Ertd300e Fam48a Supt20] Transcription factor SPT20 homolog (p38-interacting protein) (p38IP)
[MAPK14 CSBP CSBP1 CSBP2 CSPB1 MXI2 SAPK2A] Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Cytokine suppressive anti-inflammatory drug-binding protein) (CSAID-binding protein) (CSBP) (MAP kinase MXI2) (MAX-interacting protein 2) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha) (Stress-activated protein kinase 2a) (SAPK2a)
[SPT20 ADA5 YOL148C] Transcription factor SPT20
[AIMP2 JTV1 PRO0992] Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (Multisynthase complex auxiliary component p38) (Protein JTV-1)
[Mapk14 Crk1 Csbp1 Csbp2] Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (CRK1) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha)
[pmk-1 B0218.3] Mitogen-activated protein kinase pmk-1 (EC 2.7.11.24) (Stress-activated protein kinase pmk-1) (p38 MAP kinase 1)
[MAPK12 ERK6 SAPK3] Mitogen-activated protein kinase 12 (MAP kinase 12) (MAPK 12) (EC 2.7.11.24) (Extracellular signal-regulated kinase 6) (ERK-6) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) (Stress-activated protein kinase 3)
[MAPK11 PRKM11 SAPK2 SAPK2B] Mitogen-activated protein kinase 11 (MAP kinase 11) (MAPK 11) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 beta) (MAP kinase p38 beta) (p38b) (Stress-activated protein kinase 2b) (SAPK2b) (p38-2)
[Mapk14 Csbp1 Csbp2] Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (CRK1) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha)
[Mapk11 Prkm11] Mitogen-activated protein kinase 11 (MAP kinase 11) (MAPK 11) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 beta) (MAP kinase p38 beta) (p38B)
[MAPK14 CSBP1 CSBP2] Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha)
[MAPK13 PRKM13 SAPK4] Mitogen-activated protein kinase 13 (MAP kinase 13) (MAPK 13) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) (Stress-activated protein kinase 4)
[Mapk13 Serk4] Mitogen-activated protein kinase 13 (MAP kinase 13) (MAPK 13) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) (Stress-activated protein kinase 4)
[pmh1 mcr1 tfb3 SPBC776.18c] RNA polymerase II transcription factor B subunit 3 (CDK-activating kinase assembly factor MAT1 homolog) (RING finger protein pmh1) (RNA polymerase II transcription factor B 38 kDa subunit) (RNA polymerase II transcription factor B p38 subunit)
[p38b CG7393] Mitogen-activated protein kinase p38b (MAP kinase p38b) (MAPK p38b) (EC 2.7.11.24)
[Mapk12 Sapk3] Mitogen-activated protein kinase 12 (MAP kinase 12) (MAPK 12) (EC 2.7.11.24) (Extracellular signal-regulated kinase 6) (ERK-6) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) (Stress-activated protein kinase 3)
[Mapk12 Sapk3] Mitogen-activated protein kinase 12 (MAP kinase 12) (MAPK 12) (EC 2.7.11.24) (Extracellular signal-regulated kinase 6) (ERK-6) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) (Stress-activated protein kinase 3)
[Mapk13] Mitogen-activated protein kinase 13 (MAP kinase 13) (MAPK 13) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) (Stress-activated protein kinase 4)
[PA2G4 EBP1] Proliferation-associated protein 2G4 (Cell cycle protein p38-2G4 homolog) (hG4-1) (ErbB3-binding protein 1)
[Pa2g4 Ebp1 Plfap] Proliferation-associated protein 2G4 (IRES-specific cellular trans-acting factor 45 kDa) (ITAF45) (Mpp1) (Proliferation-associated protein 1) (Protein p38-2G4)
[mapk14a mapk14] Mitogen-activated protein kinase 14A (MAP kinase 14A) (MAPK 14A) (EC 2.7.11.24) (Mitogen-activated protein kinase p38a) (MAP kinase p38a) (zp38a)
[mapk14b mapk14] Mitogen-activated protein kinase 14B (MAP kinase 14B) (MAPK 14B) (EC 2.7.11.24) (Mitogen-activated protein kinase p38b) (MAP kinase p38b) (zp38b)
[pstS1 phoS1 Rv0934 MTCY08D9.05c] Phosphate-binding protein PstS 1 (PBP 1) (PhoS1) (PstS-1) (38-kDa glycolipoprotein) (38-kDa lipoprotein) (P38) (Antigen Ag78) (Protein antigen B) (Pab)
[DAB2IP AF9Q34 AIP1 KIAA1743] Disabled homolog 2-interacting protein (DAB2 interaction protein) (DAB2-interacting protein) (ASK-interacting protein 1) (AIP-1) (DOC-2/DAB-2 interactive protein)
[MAPK14 CSBP1] Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha) (Stress-activated protein kinase 2a)
[mapk14a] Mitogen-activated protein kinase 14A (MAP kinase 14A) (MAPK 14A) (EC 2.7.11.24) (Mitogen-activated protein kinase p38a) (MAP kinase p38a) (cp38a)
[mapk14b] Mitogen-activated protein kinase 14B (MAP kinase 14B) (MAPK 14B) (EC 2.7.11.24) (Mitogen-activated protein kinase p38b) (MAP kinase p38b) (cp38b)
[pmk-3 F42G8.4] Mitogen-activated protein kinase pmk-3 (EC 2.7.11.24) (Stress-activated protein kinase pmk-3) (p38 MAP kinase 3)
[Syp] Synaptophysin (Major synaptic vesicle protein p38)

Bibliography :