GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Tyrosine-protein phosphatase cdc-14 (EC 3.1.3.48) (Cell division cycle-related protein 14)

 CDC14_CAEEL             Reviewed;         709 AA.
P81299; A0A0K3AQY3; A0A0K3ATW0; P81300; Q09955; Q09976; Q6DLY2; Q6DLY3;
Q6DLY4; Q6DLY5; Q6DLY6; Q8MQD6;
30-APR-2003, integrated into UniProtKB/Swiss-Prot.
12-SEP-2018, sequence version 3.
12-AUG-2020, entry version 158.
RecName: Full=Tyrosine-protein phosphatase cdc-14;
EC=3.1.3.48 {ECO:0000255|PROSITE-ProRule:PRU10044, ECO:0000269|PubMed:12213836};
AltName: Full=Cell division cycle-related protein 14;
Name=cdc-14 {ECO:0000303|PubMed:12213836, ECO:0000303|PubMed:15247923,
ECO:0000312|WormBase:C17G10.4h};
ORFNames=C17G10.4 {ECO:0000312|WormBase:C17G10.4h};
Caenorhabditis elegans.
Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
Caenorhabditis.
NCBI_TaxID=6239;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; C; D AND E), FUNCTION, SUBCELLULAR
LOCATION, DISRUPTION PHENOTYPE, AND MUTAGENESIS OF 446-GLN--SER-709.
PubMed=15247923; DOI=10.1038/ncb1154;
Saito R.M., Perreault A., Peach B., Satterlee J.S., van den Heuvel S.;
"The CDC-14 phosphatase controls developmental cell-cycle arrest in C.
elegans.";
Nat. Cell Biol. 6:777-783(2004).
[2] {ECO:0000305}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C).
Ernsting B.R., Li L., Wishart M.J., Dixon J.E.;
Submitted (APR-1997) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=Bristol N2;
PubMed=9851916; DOI=10.1126/science.282.5396.2012;
The C. elegans sequencing consortium;
"Genome sequence of the nematode C. elegans: a platform for investigating
biology.";
Science 282:2012-2018(1998).
[4]
FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, SUBCELLULAR LOCATION,
DISRUPTION PHENOTYPE, AND MUTAGENESIS OF CYS-295.
PubMed=12213836; DOI=10.1083/jcb.200202054;
Gruneberg U., Glotzer M., Gartner A., Nigg E.A.;
"The CeCDC-14 phosphatase is required for cytokinesis in the Caenorhabditis
elegans embryo.";
J. Cell Biol. 158:901-914(2002).
[5]
FUNCTION, SUBCELLULAR LOCATION (ISOFORM C), DEVELOPMENTAL STAGE, DISRUPTION
PHENOTYPE, NUCLEAR EXPORT SIGNAL, NUCLEAR LOCALIZATION SIGNAL, AND
MUTAGENESIS OF 366-LYS--ARG-371 AND 372-LEU--LEU-381.
PubMed=21723944; DOI=10.1016/j.mod.2011.06.001;
Roy S.H., Clayton J.E., Holmen J., Beltz E., Saito R.M.;
"Control of Cdc14 activity coordinates cell cycle and development in
Caenorhabditis elegans.";
Mech. Dev. 128:317-326(2011).
-!- FUNCTION: Protein phosphatase that negatively regulates the G1-to-S
phase transition to inhibit the cell cycle and establish quiescence in
cells of multiple lineages including vulval, hypodermal and intestinal
(PubMed:15247923, PubMed:21723944). Promotes nuclear accumulation and
activity of the cyclin-dependent kinase inhibitor cki-1 which leads to
inhibition of G1 progression during vulval tissue development
(PubMed:15247923). Has been shown to not be required for cytokinesis
(PubMed:15247923). However, in the embryo, in a contrasting study, has
been shown to act as a regulator of central spindle formation and
cytokinesis, and may be required for localization of the spindle
component zen-4, and its interacting partner air-2 at the spindle
during late cell divisions (PubMed:12213836).
{ECO:0000269|PubMed:12213836, ECO:0000269|PubMed:15247923,
ECO:0000269|PubMed:21723944}.
-!- FUNCTION: [Isoform c]: Main regulator of cell cycle arrest in vulval
precursor cells. {ECO:0000269|PubMed:21723944}.
-!- CATALYTIC ACTIVITY:
Reaction=H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] +
phosphate; Xref=Rhea:RHEA:10684, Rhea:RHEA-COMP:10136, Rhea:RHEA-
COMP:10137, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:46858,
ChEBI:CHEBI:82620; EC=3.1.3.48; Evidence={ECO:0000255|PROSITE-
ProRule:PRU10044, ECO:0000269|PubMed:12213836};
-!- ACTIVITY REGULATION: Inhibited by sodium orthovanadate. Weakly
inhibited by sodium fluoride and okadaic acid.
{ECO:0000269|PubMed:12213836}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:12213836,
ECO:0000269|PubMed:15247923}. Cytoplasm, cytoskeleton, microtubule
organizing center, centrosome {ECO:0000269|PubMed:15247923}. Cytoplasm,
cytoskeleton, spindle {ECO:0000269|PubMed:12213836,
ECO:0000269|PubMed:15247923}. Midbody {ECO:0000269|PubMed:12213836}.
Nucleus {ECO:0000269|PubMed:15247923}. Note=Localizes to the cytoplasm
throughout interphase (PubMed:15247923). As cells enter prophase,
accumulates at the centrosomes (PubMed:15247923). During metaphase and
anaphase, localizes to the spindle, in particular spindle asters and
the spindle mid zone (PubMed:15247923, PubMed:12213836). During late
telophase, localizes to cytoplasmic aggregates (PubMed:15247923). In
some studies, localizes to the midbody during late telophase
(PubMed:12213836). Localizes to the cytoplasm in G1-arrested cells
(PubMed:15247923). Localizes to the nucleus or nucleolus in postmitotic
cells (PubMed:15247923). Some studies report no localization to
centrosomes or nuclei (PubMed:12213836). Co-localizes with zen-4 at the
spindle, and localization may be dependent on each other
(PubMed:12213836). {ECO:0000269|PubMed:12213836,
ECO:0000269|PubMed:15247923}.
-!- SUBCELLULAR LOCATION: [Isoform c]: Cytoplasm
{ECO:0000269|PubMed:21723944}. Nucleus {ECO:0000269|PubMed:21723944}.
Note=Localizes to the cytoplasm during interphase, but localizes to the
nucleus during cell cycle arrest. {ECO:0000269|PubMed:21723944}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=h {ECO:0000312|WormBase:C17G10.4h};
IsoId=P81299-1; Sequence=Displayed;
Name=a {ECO:0000312|WormBase:C17G10.4a};
IsoId=P81299-2; Sequence=VSP_059807, VSP_059811;
Name=c {ECO:0000312|WormBase:C17G10.4c};
IsoId=P81299-3; Sequence=VSP_059807, VSP_059808;
Name=d {ECO:0000312|WormBase:C17G10.4d};
IsoId=P81299-4; Sequence=VSP_059807;
Name=e {ECO:0000312|WormBase:C17G10.4e};
IsoId=P81299-5; Sequence=VSP_059811;
Name=g {ECO:0000312|WormBase:C17G10.4g};
IsoId=P81299-7; Sequence=VSP_059809, VSP_059810;
-!- DEVELOPMENTAL STAGE: Expressed in the soma during early embryogenesis,
and widely expressed after hatching. Isoform C: Expressed in the soma
during early embryogenesis, but after hatching, expression in larvae is
restricted to V and P lineages, the postembryonic lineages that
contribute to the seam cells and vulval precursor cells, respectively.
{ECO:0000269|PubMed:21723944}.
-!- DISRUPTION PHENOTYPE: RNAi-mediated knockdown results in extra cell
divisions in the vulval lineage, but does not result in defects in
cytokinesis (PubMed:15247923, PubMed:21723944). RNAi-mediated knockdown
decreases cki-1 expression in the nucleus of vulval precursor cells
(PubMed:15247923). In contrasting studies RNAi-mediated knockdown
results in embryonic lethality with the production of multinucleated
embryos that exhibit cytokinesis failure during telophase, no central
spindle formation, and failed localization of the spindle component
zen-4 and its interacting partner air-2 at the spindle in either
anaphase or telophase (PubMed:12213836). {ECO:0000269|PubMed:12213836,
ECO:0000269|PubMed:15247923, ECO:0000269|PubMed:21723944}.
-!- SIMILARITY: Belongs to the protein-tyrosine phosphatase family. Non-
receptor class CDC14 subfamily. {ECO:0000305}.
-!- CAUTION: Has been shown in one report to not be localized to
centrosomes or nuclei, and based on RNAi-mediated knockdown studies,
has been shown to play a role in cytokinesis (PubMed:12213836).
However, has also been reported to localize to centrosomes and nuclei
and to have no role in cytokinesis, based on results obtained using the
cdc-14 he118 mutant and RNAi-mediated knockdown (PubMed:15247923).
{ECO:0000269|PubMed:12213836, ECO:0000269|PubMed:15247923}.
-!- SEQUENCE CAUTION:
Sequence=AAT74543.1; Type=Miscellaneous discrepancy; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AY661743; AAT74542.1; -; mRNA.
EMBL; AY661744; AAT74543.1; ALT_SEQ; mRNA.
EMBL; AY661745; AAT74544.1; -; mRNA.
EMBL; AY661746; AAT74545.1; -; mRNA.
EMBL; AY661747; AAT74546.1; -; mRNA.
EMBL; AF000363; AAB94407.1; -; mRNA.
EMBL; BX284602; CCD64951.1; -; Genomic_DNA.
EMBL; BX284602; CCD64953.1; -; Genomic_DNA.
EMBL; BX284602; CCD64954.1; -; Genomic_DNA.
EMBL; BX284602; CCD64955.1; -; Genomic_DNA.
EMBL; BX284602; CTQ86448.1; -; Genomic_DNA.
EMBL; BX284602; CTQ86449.1; -; Genomic_DNA.
PIR; E88158; E88158.
PIR; T34097; T34097.
RefSeq; NP_001021969.1; NM_001026798.5. [P81299-5]
RefSeq; NP_001300509.1; NM_001313580.1.
RefSeq; NP_001300510.1; NM_001313581.1. [P81299-1]
RefSeq; NP_495085.2; NM_062684.5. [P81299-2]
RefSeq; NP_495086.1; NM_062685.3.
RefSeq; NP_740991.1; NM_170993.4. [P81299-4]
SMR; P81299; -.
BioGRID; 39287; 2.
DIP; DIP-25903N; -.
STRING; 6239.C17G10.4b.2; -.
iPTMnet; P81299; -.
EPD; P81299; -.
PaxDb; P81299; -.
PeptideAtlas; P81299; -.
PRIDE; P81299; -.
EnsemblMetazoa; C17G10.4a.1; C17G10.4a.1; WBGene00000383. [P81299-2]
EnsemblMetazoa; C17G10.4a.2; C17G10.4a.2; WBGene00000383. [P81299-2]
EnsemblMetazoa; C17G10.4c.1; C17G10.4c.1; WBGene00000383. [P81299-3]
EnsemblMetazoa; C17G10.4c.2; C17G10.4c.2; WBGene00000383. [P81299-3]
EnsemblMetazoa; C17G10.4d.1; C17G10.4d.1; WBGene00000383. [P81299-4]
EnsemblMetazoa; C17G10.4e.1; C17G10.4e.1; WBGene00000383. [P81299-5]
EnsemblMetazoa; C17G10.4e.2; C17G10.4e.2; WBGene00000383. [P81299-5]
EnsemblMetazoa; C17G10.4g.1; C17G10.4g.1; WBGene00000383. [P81299-7]
EnsemblMetazoa; C17G10.4h.1; C17G10.4h.1; WBGene00000383. [P81299-1]
GeneID; 173945; -.
KEGG; cel:CELE_C17G10.4; -.
UCSC; C17G10.4b; c. elegans. [P81299-1]
CTD; 173945; -.
WormBase; C17G10.4a; CE30868; WBGene00000383; cdc-14. [P81299-2]
WormBase; C17G10.4c; CE08288; WBGene00000383; cdc-14. [P81299-3]
WormBase; C17G10.4d; CE06845; WBGene00000383; cdc-14. [P81299-4]
WormBase; C17G10.4e; CE36916; WBGene00000383; cdc-14. [P81299-5]
WormBase; C17G10.4g; CE50122; WBGene00000383; cdc-14. [P81299-7]
WormBase; C17G10.4h; CE01789; WBGene00000383; cdc-14. [P81299-1]
eggNOG; KOG1720; Eukaryota.
GeneTree; ENSGT00940000170847; -.
HOGENOM; CLU_288890_0_0_1; -.
InParanoid; P81299; -.
KO; K06639; -.
OMA; CANGKSY; -.
OrthoDB; 1357618at2759; -.
Reactome; R-CEL-176407; Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase.
PRO; PR:P81299; -.
Proteomes; UP000001940; Chromosome II.
Bgee; WBGene00000383; Expressed in multi-cellular organism and 5 other tissues.
GO; GO:0000235; C:astral microtubule; IDA:WormBase.
GO; GO:0005813; C:centrosome; IDA:WormBase.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:1902636; C:kinociliary basal body; IBA:GO_Central.
GO; GO:0030496; C:midbody; IDA:WormBase.
GO; GO:0072686; C:mitotic spindle; IBA:GO_Central.
GO; GO:1990023; C:mitotic spindle midzone; IDA:WormBase.
GO; GO:0005730; C:nucleolus; IDA:WormBase.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0005819; C:spindle; IDA:UniProtKB.
GO; GO:0051233; C:spindle midzone; IDA:WormBase.
GO; GO:0000922; C:spindle pole; IBA:GO_Central.
GO; GO:0016791; F:phosphatase activity; IDA:WormBase.
GO; GO:0004721; F:phosphoprotein phosphatase activity; IDA:WormBase.
GO; GO:0004722; F:protein serine/threonine phosphatase activity; IBA:GO_Central.
GO; GO:0004725; F:protein tyrosine phosphatase activity; IBA:GO_Central.
GO; GO:0008138; F:protein tyrosine/serine/threonine phosphatase activity; IEA:InterPro.
GO; GO:0060271; P:cilium assembly; IBA:GO_Central.
GO; GO:0016311; P:dephosphorylation; IDA:WormBase.
GO; GO:0000226; P:microtubule cytoskeleton organization; IMP:UniProtKB.
GO; GO:0000278; P:mitotic cell cycle; IBA:GO_Central.
GO; GO:0071850; P:mitotic cell cycle arrest; IMP:WormBase.
GO; GO:0000281; P:mitotic cytokinesis; IMP:WormBase.
GO; GO:0051256; P:mitotic spindle midzone assembly; IMP:WormBase.
GO; GO:0045786; P:negative regulation of cell cycle; IDA:UniProtKB.
GO; GO:1902807; P:negative regulation of cell cycle G1/S phase transition; IMP:UniProtKB.
GO; GO:0040038; P:polar body extrusion after meiotic divisions; IMP:WormBase.
GO; GO:0032467; P:positive regulation of cytokinesis; IBA:GO_Central.
GO; GO:0006470; P:protein dephosphorylation; IDA:WormBase.
GO; GO:0060284; P:regulation of cell development; IMP:UniProtKB.
GO; GO:0007096; P:regulation of exit from mitosis; IBA:GO_Central.
GO; GO:0040028; P:regulation of vulval development; IMP:UniProtKB.
Gene3D; 3.90.190.10; -; 2.
InterPro; IPR026070; CDC14.
InterPro; IPR029260; DSPn.
InterPro; IPR000340; Dual-sp_phosphatase_cat-dom.
InterPro; IPR029021; Prot-tyrosine_phosphatase-like.
InterPro; IPR016130; Tyr_Pase_AS.
InterPro; IPR000387; TYR_PHOSPHATASE_dom.
InterPro; IPR020422; TYR_PHOSPHATASE_DUAL_dom.
PANTHER; PTHR23339:SF27; PTHR23339:SF27; 1.
Pfam; PF00782; DSPc; 1.
Pfam; PF14671; DSPn; 1.
SMART; SM00195; DSPc; 1.
SUPFAM; SSF52799; SSF52799; 2.
PROSITE; PS00383; TYR_PHOSPHATASE_1; 1.
PROSITE; PS50056; TYR_PHOSPHATASE_2; 1.
PROSITE; PS50054; TYR_PHOSPHATASE_DUAL; 1.
PROSITE; PS50950; ZF_THAP; 1.
1: Evidence at protein level;
Alternative splicing; Cell cycle; Cell division; Cytoplasm; Cytoskeleton;
Hydrolase; Microtubule; Nucleus; Protein phosphatase; Reference proteome.
CHAIN 1..709
/note="Tyrosine-protein phosphatase cdc-14"
/id="PRO_0000094880"
DOMAIN 196..354
/note="Tyrosine-protein phosphatase"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"
MOTIF 366..371
/note="Nuclear localization signal"
/evidence="ECO:0000269|PubMed:21723944"
MOTIF 372..381
/note="Nuclear export signal"
/evidence="ECO:0000269|PubMed:21723944"
ACT_SITE 295
/note="Phosphocysteine intermediate"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"
VAR_SEQ 542..555
/note="Missing (in isoform a, isoform c and isoform d)"
/evidence="ECO:0000305"
/id="VSP_059807"
VAR_SEQ 620..709
/note="ITKCSLTAESKPPKRILSMPGTSKSTSSLKKIQVSRPRPYPSTGVRVELCAN
GKSYDIRPRKEAHVIPGAGLAANTEALLGVCKLVNTLS -> FGLVRVPPDSPHSIMAH
RPPPTTSSRAPLSPHNYSTTQGYSTSSRGLYGDKKPLARGSVSTSTLPSMYMTRSCERK
(in isoform c)"
/evidence="ECO:0000305"
/id="VSP_059808"
VAR_SEQ 620..695
/note="ITKCSLTAESKPPKRILSMPGTSKSTSSLKKIQVSRPRPYPSTGVRVELCAN
GKSYDIRPRKEAHVIPGAGLAANT -> FGLVRVPPDSPHSIMAHRPPPTTSSRAPLSP
HNYSTTQGYSTSSRGLYGDKKPLARGSVSTSTLPSMYMTRSCERK (in isoform
g)"
/evidence="ECO:0000305"
/id="VSP_059809"
VAR_SEQ 696..709
/note="Missing (in isoform g)"
/evidence="ECO:0000305"
/id="VSP_059810"
VAR_SEQ 701..708
/note="VCKLVNTL -> KRRKTA (in isoform a and isoform e)"
/evidence="ECO:0000305"
/id="VSP_059811"
MUTAGEN 295
/note="C->S: Abolishes phosphatase activity."
/evidence="ECO:0000269|PubMed:12213836"
MUTAGEN 366..371
/note="KRNVRR->AANVAA: Disrupts nuclear localization.
Localizes to the cytoplasm; when associated with 372-A--A-
381."
/evidence="ECO:0000269|PubMed:21723944"
MUTAGEN 372..381
/note="LVNQVDDINL->AVNQVDDANA: Impairs nuclear export
signal. Disrupts cytoplasmic localization, conferring
nuclear localization during interphase. Localizes to the
cytoplasm; when associated with 366-A--A-371."
/evidence="ECO:0000269|PubMed:21723944"
MUTAGEN 446..709
/note="Missing: In he118; no effect on viability,
embryogenesis or fertility. Disrupts cell cycle arrest of
vulval precursor, intestinal, and hypodermal cells, and of
precursor cells that give rise to male specific structures
during postembryonic development. Vulval precursor cells
undergo an extra round of cell division during the L2
larval stage of development, but the additional precursor
cells do not disrupt formation of the vulval structure and
animals undergo normal vulval morphogenesis during the L4
larval stage. Does not result in defects in cytokinesis.
Overexpression of the cyclin dependent kinase inhibitor
cki-1, or knockout with the G1/S-specific cyclin-E cye-1
(eh10), rescues the cell division phenotype."
/evidence="ECO:0000269|PubMed:15247923"
SEQUENCE 709 AA; 79740 MW; AB5873D8C7FEDB0C CRC64;
MREDHSPRRN NTIENTLTEL LPNRLYFGCF PNPDAIDKSD KSVKKTCFIN INNKFHYEPF
YEDFGPWNLS VLYRLCVQVG KLLEVEEKRS RRVVLFCQDD GTGQYDKIRV NTAYVLGAYL
IIYQGFSADD AYLKVSSGET VKFVGFRDAS MGSPQYLLHL HDVLRGIEKA LKFGWLDFSD
FDYEEYEFYE RVENGDFNWI IPGKILSFCG PHNESREENG YPYHAPDVYF DYFRENKVST
IVRLNAKNYD ASKFTKAGFD HVDLFFIDGS TPSDEIMLKF IKVVDNTKGG VAVHCKAGLG
RTGTLIACWM MKEYGLTAGE CMGWLRVCRP GSVIGPQQPY LIEKQKFCWS LSQSNGVHLT
QNKEEKRNVR RLVNQVDDIN LGEERISPKS RENTRPNILR RRVQVQNGRS TAPVTIAPAG
TSESRRSTKP SRVVDETALD DQGRSQGDRL LQLKAKHQHE SETTSPNSSS SRRFVKSSTP
QMTVPSQAYL NRNREPIIVT PSKNGTSSGT SSRQLKTTPN GNVAYRTRNS SGNTTSTLTR
TGNESYRFHN SLFYEPASAV FPSMASRRSE TTRYLSPTTP IKPMSPSYTD GTSPRYKARL
RSENPIGSTT STPFSLQPQI TKCSLTAESK PPKRILSMPG TSKSTSSLKK IQVSRPRPYP
STGVRVELCA NGKSYDIRPR KEAHVIPGAG LAANTEALLG VCKLVNTLS


Related products :

Catalog number Product name Quantity
EIAAB06507 CDC2L,CDC2L5,CDC2-related protein kinase 5,CDK13,Cell division cycle 2-like protein kinase 5,Cell division protein kinase 13,CHED,Cholinesterase-related cell division controller,Cyclin-dependent kinas
EIAAB06505 Cdc2l5,CDC2-related protein kinase 5,Cdk13,Cell division cycle 2-like protein kinase 5,Cell division protein kinase 13,Cyclin-dependent kinase 13,Kiaa1791,Mouse,Mus musculus
EIAAB06506 Bos taurus,Bovine,CDC2L,CDC2L5,CDC2-related protein kinase 5,CDK13,Cell division cycle 2-like protein kinase 5,Cell division protein kinase 13,Cyclin-dependent kinase 13
EIAAB06521 Cdc2l6,CDC2-related protein kinase 6,Cdk19,Cell division cycle 2-like protein kinase 6,Cell division protein kinase 19,Cyclin-dependent kinase 19,Kiaa1028,Mouse,Mus musculus
EIAAB06502 Cdc2-related kinase, arginine_serine-rich,CDC2-related protein kinase 7,Cdk12,Cell division cycle 2-related protein kinase 7,Cell division protein kinase 12,Crk7,CrkRS,Crkrs,Cyclin-dependent kinase 12
EIAAB06503 Cdc2-related kinase, arginine_serine-rich,CDC2-related protein kinase 7,CDK12,Cell division cycle 2-related protein kinase 7,Cell division protein kinase 12,CRK7,CrkRS,CRKRS,Cyclin-dependent kinase 12
EIAAB06501 Cdc2-related kinase, arginine_serine-rich,CDC2-related protein kinase 7,Cdk12,Cell division cycle 2-related protein kinase 7,Cell division protein kinase 12,Crk7,CrkRS,Crkrs,Cyclin-dependent kinase 12
EIAAB33052 HCP,Hematopoietic cell protein-tyrosine phosphatase,Homo sapiens,Human,Protein-tyrosine phosphatase 1C,Protein-tyrosine phosphatase SHP-1,PTP1C,PTP-1C,PTPN6,SH-PTP1,Tyrosine-protein phosphatase non-re
EIAAB33119 Embryonic stem cell protein-tyrosine phosphatase,ES cell phosphatase,Esp,Osteotesticular protein-tyrosine phosphatase,OST-PTP,Ptprv,Rat,Rattus norvegicus,Receptor-type tyrosine-protein phosphatase V,R
EIAAB06450 Cdc5l,Cdc5-like protein,Cell division cycle 5-related protein,Pcdc5rp,Pombe Cdc5-related protein,Rat,Rattus norvegicus
EIAAB06448 Cdc5l,Cdc5-like protein,Cell division cycle 5-related protein,Kiaa0432,Mouse,Mus musculus
E10813m Rat ELISA Kit FOR Cell division cycle 5-related protein 96T
EIAAB06522 CDC2L6,CDC2-related protein kinase 6,CDK11,CDK19,Cell division cycle 2-like protein kinase 6,Cell division protein kinase 19,Cyclin-dependent kinase 11,Cyclin-dependent kinase 19,Death-preventing kina
EIAAB31094 Cdc91l1,Cell division cycle protein 91-like 1,GPI transamidase component PIG-U,Liver regeneration-related protein LRRGT00059,Phosphatidylinositol glycan anchor biosynthesis class U protein,Pigu,Protei
EIAAB33053 70Z-SHP,Hcp,Hcph,Hematopoietic cell protein-tyrosine phosphatase,Mouse,Mus musculus,Protein-tyrosine phosphatase 1C,Ptp1C,PTP-1C,Ptpn6,PTPTY-42,SHP-1,SH-PTP1,Tyrosine-protein phosphatase non-receptor
GWB-E29212 Anti- Cell division cycle 2-related protein kinase 7 Antibody
GWB-10F9BA Anti- Cell division cycle 7-related protein kinase Antibody
E1472r Human ELISA Kit FOR Cell division cycle 7-related protein kinase 96T
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.005 mg
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.01 mg
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.02 mg
PP-SHP1-020 SHP-1, Tyrosine-protein phosphatase non-receptor type 6, EC 3.1.3.48, Protein-tyrosine phosphatase 1C, PTP-1C, Hematopoietic cell protein-tyrosine phosphatase, SH-PTP1, Protein-tyrosine phosphatase SH 20
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.001 mg
EIAAB06449 CDC5L,Cdc5-like protein,Cell division cycle 5-like protein,Homo sapiens,Human,KIAA0432,PCDC5RP,Pombe cdc5-related protein
CSB-EL005023HU Human Cell division cycle 7-related protein kinase(CDC7) ELISA kit 96T
Pathways :
WP2199: Seed Development
WP1566: Citrate cycle (TCA cycle)
WP1654: gamma-Hexachlorocyclohexane degradation
WP2272: Pathogenic Escherichia coli infection
WP414: Cell Cycle and Cell Division
WP1714: Tyrosine metabolism
WP731: Sterol regulatory element binding protein related
WP76: TCA Cycle
WP1675: Nitrogen metabolism
WP190: Cell cycle
WP2324: AGE/RAGE pathway
WP45: G1 to S cell cycle control
WP959: G1 to S cell cycle control
WP1775: Cell Cycle Checkpoints
WP1049: G Protein Signaling Pathways
WP1624: Bacterial secretion system
WP1792: Cell Cycle, Mitotic
WP346: Protein Modifications
WP1685: Peptidoglycan biosynthesis
WP813: G Protein Signaling Pathways
WP1393: Cell cycle
WP1690: Propanoate metabolism
WP1083: Cell cycle
WP1650: Fluorobenzoate degradation
WP35: G Protein Signaling Pathways

Related Genes :
[cdc-14 C17G10.4] Tyrosine-protein phosphatase cdc-14 (EC 3.1.3.48) (Cell division cycle-related protein 14)
[CDC14A] Dual specificity protein phosphatase CDC14A (EC 3.1.3.16) (EC 3.1.3.48) (CDC14 cell division cycle 14 homolog A)
[clp1 flp1 SPAC1782.09c] Tyrosine-protein phosphatase CDC14 homolog (EC 3.1.3.48) (CDC fourteen-like phosphatase 1)
[cdc-48.1 C06A1.1] Transitional endoplasmic reticulum ATPase homolog 1 (EC 3.6.4.6) (Cell division cycle-related protein 48.1) (p97/CDC48 homolog 1)
[CDK13 CDC2L CDC2L5 CHED KIAA1791] Cyclin-dependent kinase 13 (EC 2.7.11.22) (EC 2.7.11.23) (CDC2-related protein kinase 5) (Cell division cycle 2-like protein kinase 5) (Cell division protein kinase 13) (hCDK13) (Cholinesterase-related cell division controller)
[cdc-48.2 C41C4.8] Transitional endoplasmic reticulum ATPase homolog 2 (EC 3.6.4.6) (Cell division cycle-related protein 48.2) (p97/CDC48 homolog 2)
[cdc-48.3 K04G2.3] ATPase family protein 2 homolog (EC 3.6.4.10) (Cell division cycle-related protein 48.3)
[CDC48 YDL126C] Cell division control protein 48 (EC 3.6.4.6) (Cell division cycle protein 48) (Transitional endoplasmic reticulum ATPase homolog)
[CDC7 CDC7L1] Cell division cycle 7-related protein kinase (CDC7-related kinase) (HsCdc7) (huCdc7) (EC 2.7.11.1)
[Cdc7 Cdc7l1] Cell division cycle 7-related protein kinase (CDC7-related kinase) (muCdc7) (EC 2.7.11.1)
[CDK9 CDC2L4 TAK] Cyclin-dependent kinase 9 (EC 2.7.11.22) (EC 2.7.11.23) (C-2K) (Cell division cycle 2-like protein kinase 4) (Cell division protein kinase 9) (Serine/threonine-protein kinase PITALRE) (Tat-associated kinase complex catalytic subunit)
[Ptpn6 Hcp Hcph Ptp1C] Tyrosine-protein phosphatase non-receptor type 6 (EC 3.1.3.48) (70Z-SHP) (Hematopoietic cell protein-tyrosine phosphatase) (PTPTY-42) (Protein-tyrosine phosphatase 1C) (PTP-1C) (SH-PTP1) (SHP-1)
[hchA hchA_1 AM465_15370 AWF59_019055 AZZ83_004235 B9N33_26475 BFD68_20845 C7B02_06890 C9Z28_17130 CCZ14_26645 CCZ17_22700 CRJUMX01_1140054 CRT43_11430 CUB99_23505 D3C88_02905 D3P02_16265 D9D33_15385 D9D94_15735 D9E49_19020 D9I20_10460 D9J46_03345 DJ487_18960 DJ492_13470 DL251_00505 DL979_00380 DMC44_18755 DMZ50_24495 DNR41_00375 DS966_16070 DU333_03260 DW236_02290 E0L04_20335 EA159_21345 EA167_21075 EA189_00370 EA191_21560 EA198_02280 EA200_00370 EA203_21510 EA222_02305 EA232_20265 EA233_11705 EA242_17410 EA245_13290 EA429_05770 EA435_21775 EA834_21700 ECTO124_02024 EGT48_04930 ELT22_00120 ELT23_21030 ELT33_08025 ELU82_24705 ELU96_05025 ELV13_26065 ELV22_24670 ELX56_18060 ELX70_18575 ELX79_15035 ELX83_25640 ELY23_20490 ELY24_19085 ELY50_24510 EPS76_06485 EPS91_17475 EPS94_00505 ERS085406_02591 EWK56_00075 ExPECSC065_02714 EYX99_25670 FNJ67_10775 FV295_16190 GFU40_00360 GFU45_09680 GFU47_04835 GJ638_18410 GKE92_23545 GKF28_00040 GKF34_00055 GKF47_00040 GKG08_13460 GKG09_11990 GKG11_12245 GKG22_12830 GKG29_13740 GQE47_24120 GQN33_12435 GQS26_09145 HmCmsJML236_01281 NCTC10766_03778 NCTC7928_05955 NCTC8450_02317 NCTC9007_02951 NCTC9075_02834 SY51_11150 U12A_02105 U14A_02105] Protein/nucleic acid deglycase HchA (EC 3.1.2.-) (EC 3.5.1.124) (Maillard deglycase)
[PTPRN2 KIAA0387] Receptor-type tyrosine-protein phosphatase N2 (R-PTP-N2) (EC 3.1.3.-) (EC 3.1.3.48) (Islet cell autoantigen-related protein) (IAR) (ICAAR) (Phogrin) [Cleaved into: IA-2beta60]
[CDC25C] M-phase inducer phosphatase 3 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25C)
[CDK11A CDC2L2 CDC2L3 PITSLREB] Cyclin-dependent kinase 11A (EC 2.7.11.22) (Cell division cycle 2-like protein kinase 2) (Cell division protein kinase 11A) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L2)
[Cdk1 Cdc2 Cdc2a Cdkn1] Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase)
[SIW14 OCA3 YNL032W N2746] Inositol phosphatase SIW14 (EC 3.6.1.52) (5-PP-InsP phosphatase) (Inositol pyrophosphate phosphatase SIW14) (Oxidant-induced cell-cycle arrest protein 3) (Synthetic interaction with WHI2 protein 14)
[Cdk11b Cdc2l1 Cdk11] Cyclin-dependent kinase 11B (Cell division cycle 2-like protein kinase 1) (Cell division protein kinase 11) (Cyclin-dependent kinase 11) (EC 2.7.11.22) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L1)
[CDC48A CDC48 At3g09840 F8A24.11] Cell division control protein 48 homolog A (AtCDC48a)
[CDK11B CDC2L1 CDK11 PITSLREA PK58] Cyclin-dependent kinase 11B (EC 2.7.11.22) (Cell division cycle 2-like protein kinase 1) (CLK-1) (Cell division protein kinase 11B) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L1) (p58 CLK-1)
[CDKA-1 CDC2 CDC2A At3g48750 T21J18.20] Cyclin-dependent kinase A-1 (CDKA;1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog A) (CDC2aAt)
[mat-3 apc-8 cdc-23 pod-4 vex-2 F10C5.1] Cell division cycle protein 23 homolog (Anaphase-promoting complex subunit 8) (APC8) (Metaphase-to-anaphase transition defect protein 3)
[PTPN11 PTP2C SHPTP2] Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1D) (PTP-1D) (Protein-tyrosine phosphatase 2C) (PTP-2C) (SH-PTP2) (SHP-2) (Shp2) (SH-PTP3)
[PTPN2 PTPT] Tyrosine-protein phosphatase non-receptor type 2 (EC 3.1.3.48) (T-cell protein-tyrosine phosphatase) (TCPTP)
[gag-pol] Gag-Pol polyprotein (Pr180gag-pol) [Cleaved into: Matrix protein p15 (MA); RNA-binding phosphoprotein p12 (pp12); Capsid protein p30 (CA); Nucleocapsid protein p10 (NC-pol); Protease p14 (PR) (EC 3.4.23.-); Reverse transcriptase/ribonuclease H p80 (RT) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4); Integrase p46 (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[Ptpn14] Tyrosine-protein phosphatase non-receptor type 14 (EC 3.1.3.48) (Protein-tyrosine phosphatase PTP36)
[PTPN13 PNP1 PTP1E PTPL1] Tyrosine-protein phosphatase non-receptor type 13 (EC 3.1.3.48) (Fas-associated protein-tyrosine phosphatase 1) (FAP-1) (PTP-BAS) (Protein-tyrosine phosphatase 1E) (PTP-E1) (hPTPE1) (Protein-tyrosine phosphatase PTPL1)
[Ptpn13 Ptp14] Tyrosine-protein phosphatase non-receptor type 13 (EC 3.1.3.48) (PTP36) (Protein tyrosine phosphatase DPZPTP) (Protein tyrosine phosphatase PTP-BL) (Protein-tyrosine phosphatase RIP)
[CDC42] Cell division control protein 42 homolog (EC 3.6.5.2) (G25K GTP-binding protein)

Bibliography :