GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Tyrosine-protein phosphatase cdc-14 (EC 3.1.3.48) (Cell division cycle-related protein 14)

 CDC14_CAEEL             Reviewed;         709 AA.
P81299; A0A0K3AQY3; A0A0K3ATW0; P81300; Q09955; Q09976; Q6DLY2; Q6DLY3;
Q6DLY4; Q6DLY5; Q6DLY6; Q8MQD6;
30-APR-2003, integrated into UniProtKB/Swiss-Prot.
12-SEP-2018, sequence version 3.
07-APR-2021, entry version 161.
RecName: Full=Tyrosine-protein phosphatase cdc-14;
EC=3.1.3.48 {ECO:0000255|PROSITE-ProRule:PRU10044, ECO:0000269|PubMed:12213836};
AltName: Full=Cell division cycle-related protein 14;
Name=cdc-14 {ECO:0000303|PubMed:12213836, ECO:0000303|PubMed:15247923,
ECO:0000312|WormBase:C17G10.4h};
ORFNames=C17G10.4 {ECO:0000312|WormBase:C17G10.4h};
Caenorhabditis elegans.
Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
Caenorhabditis.
NCBI_TaxID=6239;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; C; D AND E), FUNCTION, SUBCELLULAR
LOCATION, DISRUPTION PHENOTYPE, AND MUTAGENESIS OF 446-GLN--SER-709.
PubMed=15247923; DOI=10.1038/ncb1154;
Saito R.M., Perreault A., Peach B., Satterlee J.S., van den Heuvel S.;
"The CDC-14 phosphatase controls developmental cell-cycle arrest in C.
elegans.";
Nat. Cell Biol. 6:777-783(2004).
[2] {ECO:0000305}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C).
Ernsting B.R., Li L., Wishart M.J., Dixon J.E.;
Submitted (APR-1997) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=Bristol N2;
PubMed=9851916; DOI=10.1126/science.282.5396.2012;
The C. elegans sequencing consortium;
"Genome sequence of the nematode C. elegans: a platform for investigating
biology.";
Science 282:2012-2018(1998).
[4]
FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, SUBCELLULAR LOCATION,
DISRUPTION PHENOTYPE, AND MUTAGENESIS OF CYS-295.
PubMed=12213836; DOI=10.1083/jcb.200202054;
Gruneberg U., Glotzer M., Gartner A., Nigg E.A.;
"The CeCDC-14 phosphatase is required for cytokinesis in the Caenorhabditis
elegans embryo.";
J. Cell Biol. 158:901-914(2002).
[5]
FUNCTION, SUBCELLULAR LOCATION (ISOFORM C), DEVELOPMENTAL STAGE, DISRUPTION
PHENOTYPE, NUCLEAR EXPORT SIGNAL, NUCLEAR LOCALIZATION SIGNAL, AND
MUTAGENESIS OF 366-LYS--ARG-371 AND 372-LEU--LEU-381.
PubMed=21723944; DOI=10.1016/j.mod.2011.06.001;
Roy S.H., Clayton J.E., Holmen J., Beltz E., Saito R.M.;
"Control of Cdc14 activity coordinates cell cycle and development in
Caenorhabditis elegans.";
Mech. Dev. 128:317-326(2011).
-!- FUNCTION: Protein phosphatase that negatively regulates the G1-to-S
phase transition to inhibit the cell cycle and establish quiescence in
cells of multiple lineages including vulval, hypodermal and intestinal
(PubMed:15247923, PubMed:21723944). Promotes nuclear accumulation and
activity of the cyclin-dependent kinase inhibitor cki-1 which leads to
inhibition of G1 progression during vulval tissue development
(PubMed:15247923). Has been shown to not be required for cytokinesis
(PubMed:15247923). However, in the embryo, in a contrasting study, has
been shown to act as a regulator of central spindle formation and
cytokinesis, and may be required for localization of the spindle
component zen-4, and its interacting partner air-2 at the spindle
during late cell divisions (PubMed:12213836).
{ECO:0000269|PubMed:12213836, ECO:0000269|PubMed:15247923,
ECO:0000269|PubMed:21723944}.
-!- FUNCTION: [Isoform c]: Main regulator of cell cycle arrest in vulval
precursor cells. {ECO:0000269|PubMed:21723944}.
-!- CATALYTIC ACTIVITY:
Reaction=H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] +
phosphate; Xref=Rhea:RHEA:10684, Rhea:RHEA-COMP:10136, Rhea:RHEA-
COMP:10137, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:46858,
ChEBI:CHEBI:82620; EC=3.1.3.48; Evidence={ECO:0000255|PROSITE-
ProRule:PRU10044, ECO:0000269|PubMed:12213836};
-!- ACTIVITY REGULATION: Inhibited by sodium orthovanadate. Weakly
inhibited by sodium fluoride and okadaic acid.
{ECO:0000269|PubMed:12213836}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:12213836,
ECO:0000269|PubMed:15247923}. Cytoplasm, cytoskeleton, microtubule
organizing center, centrosome {ECO:0000269|PubMed:15247923}. Cytoplasm,
cytoskeleton, spindle {ECO:0000269|PubMed:12213836,
ECO:0000269|PubMed:15247923}. Midbody {ECO:0000269|PubMed:12213836}.
Nucleus {ECO:0000269|PubMed:15247923}. Note=Localizes to the cytoplasm
throughout interphase (PubMed:15247923). As cells enter prophase,
accumulates at the centrosomes (PubMed:15247923). During metaphase and
anaphase, localizes to the spindle, in particular spindle asters and
the spindle mid zone (PubMed:15247923, PubMed:12213836). During late
telophase, localizes to cytoplasmic aggregates (PubMed:15247923). In
some studies, localizes to the midbody during late telophase
(PubMed:12213836). Localizes to the cytoplasm in G1-arrested cells
(PubMed:15247923). Localizes to the nucleus or nucleolus in postmitotic
cells (PubMed:15247923). Some studies report no localization to
centrosomes or nuclei (PubMed:12213836). Co-localizes with zen-4 at the
spindle, and localization may be dependent on each other
(PubMed:12213836). {ECO:0000269|PubMed:12213836,
ECO:0000269|PubMed:15247923}.
-!- SUBCELLULAR LOCATION: [Isoform c]: Cytoplasm
{ECO:0000269|PubMed:21723944}. Nucleus {ECO:0000269|PubMed:21723944}.
Note=Localizes to the cytoplasm during interphase, but localizes to the
nucleus during cell cycle arrest. {ECO:0000269|PubMed:21723944}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=h {ECO:0000312|WormBase:C17G10.4h};
IsoId=P81299-1; Sequence=Displayed;
Name=a {ECO:0000312|WormBase:C17G10.4a};
IsoId=P81299-2; Sequence=VSP_059807, VSP_059811;
Name=c {ECO:0000312|WormBase:C17G10.4c};
IsoId=P81299-3; Sequence=VSP_059807, VSP_059808;
Name=d {ECO:0000312|WormBase:C17G10.4d};
IsoId=P81299-4; Sequence=VSP_059807;
Name=e {ECO:0000312|WormBase:C17G10.4e};
IsoId=P81299-5; Sequence=VSP_059811;
Name=g {ECO:0000312|WormBase:C17G10.4g};
IsoId=P81299-7; Sequence=VSP_059809, VSP_059810;
-!- DEVELOPMENTAL STAGE: Expressed in the soma during early embryogenesis,
and widely expressed after hatching. Isoform C: Expressed in the soma
during early embryogenesis, but after hatching, expression in larvae is
restricted to V and P lineages, the postembryonic lineages that
contribute to the seam cells and vulval precursor cells, respectively.
{ECO:0000269|PubMed:21723944}.
-!- DISRUPTION PHENOTYPE: RNAi-mediated knockdown results in extra cell
divisions in the vulval lineage, but does not result in defects in
cytokinesis (PubMed:15247923, PubMed:21723944). RNAi-mediated knockdown
decreases cki-1 expression in the nucleus of vulval precursor cells
(PubMed:15247923). In contrasting studies RNAi-mediated knockdown
results in embryonic lethality with the production of multinucleated
embryos that exhibit cytokinesis failure during telophase, no central
spindle formation, and failed localization of the spindle component
zen-4 and its interacting partner air-2 at the spindle in either
anaphase or telophase (PubMed:12213836). {ECO:0000269|PubMed:12213836,
ECO:0000269|PubMed:15247923, ECO:0000269|PubMed:21723944}.
-!- SIMILARITY: Belongs to the protein-tyrosine phosphatase family. Non-
receptor class CDC14 subfamily. {ECO:0000305}.
-!- CAUTION: Has been shown in one report to not be localized to
centrosomes or nuclei, and based on RNAi-mediated knockdown studies,
has been shown to play a role in cytokinesis (PubMed:12213836).
However, has also been reported to localize to centrosomes and nuclei
and to have no role in cytokinesis, based on results obtained using the
cdc-14 he118 mutant and RNAi-mediated knockdown (PubMed:15247923).
{ECO:0000269|PubMed:12213836, ECO:0000269|PubMed:15247923}.
-!- SEQUENCE CAUTION:
Sequence=AAT74543.1; Type=Miscellaneous discrepancy; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AY661743; AAT74542.1; -; mRNA.
EMBL; AY661744; AAT74543.1; ALT_SEQ; mRNA.
EMBL; AY661745; AAT74544.1; -; mRNA.
EMBL; AY661746; AAT74545.1; -; mRNA.
EMBL; AY661747; AAT74546.1; -; mRNA.
EMBL; AF000363; AAB94407.1; -; mRNA.
EMBL; BX284602; CCD64951.1; -; Genomic_DNA.
EMBL; BX284602; CCD64953.1; -; Genomic_DNA.
EMBL; BX284602; CCD64954.1; -; Genomic_DNA.
EMBL; BX284602; CCD64955.1; -; Genomic_DNA.
EMBL; BX284602; CTQ86448.1; -; Genomic_DNA.
EMBL; BX284602; CTQ86449.1; -; Genomic_DNA.
PIR; E88158; E88158.
PIR; T34097; T34097.
RefSeq; NP_001021969.1; NM_001026798.5. [P81299-5]
RefSeq; NP_001300509.1; NM_001313580.1.
RefSeq; NP_001300510.1; NM_001313581.1. [P81299-1]
RefSeq; NP_495085.2; NM_062684.5.
RefSeq; NP_495086.1; NM_062685.3.
RefSeq; NP_740991.1; NM_170993.4.
SMR; P81299; -.
BioGRID; 39287; 7.
DIP; DIP-25903N; -.
STRING; 6239.C17G10.4b.2; -.
iPTMnet; P81299; -.
EPD; P81299; -.
PaxDb; P81299; -.
PeptideAtlas; P81299; -.
EnsemblMetazoa; C17G10.4a.1; C17G10.4a.1; WBGene00000383. [P81299-2]
EnsemblMetazoa; C17G10.4a.2; C17G10.4a.2; WBGene00000383. [P81299-2]
EnsemblMetazoa; C17G10.4c.1; C17G10.4c.1; WBGene00000383. [P81299-3]
EnsemblMetazoa; C17G10.4c.2; C17G10.4c.2; WBGene00000383. [P81299-3]
EnsemblMetazoa; C17G10.4d.1; C17G10.4d.1; WBGene00000383. [P81299-4]
EnsemblMetazoa; C17G10.4e.1; C17G10.4e.1; WBGene00000383. [P81299-5]
EnsemblMetazoa; C17G10.4e.2; C17G10.4e.2; WBGene00000383. [P81299-5]
EnsemblMetazoa; C17G10.4g.1; C17G10.4g.1; WBGene00000383. [P81299-7]
EnsemblMetazoa; C17G10.4h.1; C17G10.4h.1; WBGene00000383. [P81299-1]
GeneID; 173945; -.
UCSC; C17G10.4b; c. elegans. [P81299-1]
CTD; 173945; -.
WormBase; C17G10.4a; CE30868; WBGene00000383; cdc-14. [P81299-2]
WormBase; C17G10.4c; CE08288; WBGene00000383; cdc-14. [P81299-3]
WormBase; C17G10.4d; CE06845; WBGene00000383; cdc-14. [P81299-4]
WormBase; C17G10.4e; CE36916; WBGene00000383; cdc-14. [P81299-5]
WormBase; C17G10.4g; CE50122; WBGene00000383; cdc-14. [P81299-7]
WormBase; C17G10.4h; CE01789; WBGene00000383; cdc-14. [P81299-1]
eggNOG; KOG1720; Eukaryota.
GeneTree; ENSGT00940000170847; -.
HOGENOM; CLU_288890_0_0_1; -.
InParanoid; P81299; -.
OMA; CANGKSY; -.
OrthoDB; 1357618at2759; -.
Reactome; R-CEL-176407; Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase.
Reactome; R-CEL-5687128; MAPK6/MAPK4 signaling.
PRO; PR:P81299; -.
Proteomes; UP000001940; Chromosome II.
Bgee; WBGene00000383; Expressed in multi-cellular organism and 5 other tissues.
GO; GO:0000235; C:astral microtubule; IDA:WormBase.
GO; GO:0005813; C:centrosome; IDA:WormBase.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:1902636; C:kinociliary basal body; IBA:GO_Central.
GO; GO:0030496; C:midbody; IDA:WormBase.
GO; GO:0072686; C:mitotic spindle; IBA:GO_Central.
GO; GO:1990023; C:mitotic spindle midzone; IDA:WormBase.
GO; GO:0005730; C:nucleolus; IDA:WormBase.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0005819; C:spindle; IDA:UniProtKB.
GO; GO:0051233; C:spindle midzone; IDA:WormBase.
GO; GO:0000922; C:spindle pole; IBA:GO_Central.
GO; GO:0016791; F:phosphatase activity; IDA:WormBase.
GO; GO:0004721; F:phosphoprotein phosphatase activity; IDA:WormBase.
GO; GO:0004722; F:protein serine/threonine phosphatase activity; IBA:GO_Central.
GO; GO:0004725; F:protein tyrosine phosphatase activity; IBA:GO_Central.
GO; GO:0008138; F:protein tyrosine/serine/threonine phosphatase activity; IEA:InterPro.
GO; GO:0060271; P:cilium assembly; IBA:GO_Central.
GO; GO:0016311; P:dephosphorylation; IDA:WormBase.
GO; GO:0000226; P:microtubule cytoskeleton organization; IMP:UniProtKB.
GO; GO:0000278; P:mitotic cell cycle; IBA:GO_Central.
GO; GO:0071850; P:mitotic cell cycle arrest; IMP:WormBase.
GO; GO:0000281; P:mitotic cytokinesis; IMP:WormBase.
GO; GO:0051256; P:mitotic spindle midzone assembly; IMP:WormBase.
GO; GO:0045786; P:negative regulation of cell cycle; IDA:UniProtKB.
GO; GO:1902807; P:negative regulation of cell cycle G1/S phase transition; IMP:UniProtKB.
GO; GO:0040038; P:polar body extrusion after meiotic divisions; IMP:WormBase.
GO; GO:0032467; P:positive regulation of cytokinesis; IBA:GO_Central.
GO; GO:0006470; P:protein dephosphorylation; IDA:WormBase.
GO; GO:0060284; P:regulation of cell development; IMP:UniProtKB.
GO; GO:0007096; P:regulation of exit from mitosis; IBA:GO_Central.
GO; GO:0040028; P:regulation of vulval development; IMP:UniProtKB.
CDD; cd14499; CDC14_C; 1.
CDD; cd17657; CDC14_N; 1.
Gene3D; 3.90.190.10; -; 2.
InterPro; IPR026070; CDC14.
InterPro; IPR044506; CDC14_C.
InterPro; IPR029260; DSPn.
InterPro; IPR029021; Prot-tyrosine_phosphatase-like.
InterPro; IPR016130; Tyr_Pase_AS.
InterPro; IPR000387; TYR_PHOSPHATASE_dom.
InterPro; IPR020422; TYR_PHOSPHATASE_DUAL_dom.
PANTHER; PTHR23339:SF27; PTHR23339:SF27; 1.
Pfam; PF14671; DSPn; 1.
SMART; SM00195; DSPc; 1.
SUPFAM; SSF52799; SSF52799; 2.
PROSITE; PS00383; TYR_PHOSPHATASE_1; 1.
PROSITE; PS50056; TYR_PHOSPHATASE_2; 1.
PROSITE; PS50054; TYR_PHOSPHATASE_DUAL; 1.
1: Evidence at protein level;
Alternative splicing; Cell cycle; Cell division; Cytoplasm; Cytoskeleton;
Hydrolase; Microtubule; Nucleus; Protein phosphatase; Reference proteome.
CHAIN 1..709
/note="Tyrosine-protein phosphatase cdc-14"
/id="PRO_0000094880"
DOMAIN 196..354
/note="Tyrosine-protein phosphatase"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"
MOTIF 366..371
/note="Nuclear localization signal"
/evidence="ECO:0000269|PubMed:21723944"
MOTIF 372..381
/note="Nuclear export signal"
/evidence="ECO:0000269|PubMed:21723944"
ACT_SITE 295
/note="Phosphocysteine intermediate"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"
VAR_SEQ 542..555
/note="Missing (in isoform a, isoform c and isoform d)"
/evidence="ECO:0000305"
/id="VSP_059807"
VAR_SEQ 620..709
/note="ITKCSLTAESKPPKRILSMPGTSKSTSSLKKIQVSRPRPYPSTGVRVELCAN
GKSYDIRPRKEAHVIPGAGLAANTEALLGVCKLVNTLS -> FGLVRVPPDSPHSIMAH
RPPPTTSSRAPLSPHNYSTTQGYSTSSRGLYGDKKPLARGSVSTSTLPSMYMTRSCERK
(in isoform c)"
/evidence="ECO:0000305"
/id="VSP_059808"
VAR_SEQ 620..695
/note="ITKCSLTAESKPPKRILSMPGTSKSTSSLKKIQVSRPRPYPSTGVRVELCAN
GKSYDIRPRKEAHVIPGAGLAANT -> FGLVRVPPDSPHSIMAHRPPPTTSSRAPLSP
HNYSTTQGYSTSSRGLYGDKKPLARGSVSTSTLPSMYMTRSCERK (in isoform
g)"
/evidence="ECO:0000305"
/id="VSP_059809"
VAR_SEQ 696..709
/note="Missing (in isoform g)"
/evidence="ECO:0000305"
/id="VSP_059810"
VAR_SEQ 701..708
/note="VCKLVNTL -> KRRKTA (in isoform a and isoform e)"
/evidence="ECO:0000305"
/id="VSP_059811"
MUTAGEN 295
/note="C->S: Abolishes phosphatase activity."
/evidence="ECO:0000269|PubMed:12213836"
MUTAGEN 366..371
/note="KRNVRR->AANVAA: Disrupts nuclear localization.
Localizes to the cytoplasm; when associated with 372-A--A-
381."
/evidence="ECO:0000269|PubMed:21723944"
MUTAGEN 372..381
/note="LVNQVDDINL->AVNQVDDANA: Impairs nuclear export
signal. Disrupts cytoplasmic localization, conferring
nuclear localization during interphase. Localizes to the
cytoplasm; when associated with 366-A--A-371."
/evidence="ECO:0000269|PubMed:21723944"
MUTAGEN 446..709
/note="Missing: In he118; no effect on viability,
embryogenesis or fertility. Disrupts cell cycle arrest of
vulval precursor, intestinal, and hypodermal cells, and of
precursor cells that give rise to male specific structures
during postembryonic development. Vulval precursor cells
undergo an extra round of cell division during the L2
larval stage of development, but the additional precursor
cells do not disrupt formation of the vulval structure and
animals undergo normal vulval morphogenesis during the L4
larval stage. Does not result in defects in cytokinesis.
Overexpression of the cyclin dependent kinase inhibitor
cki-1, or knockout with the G1/S-specific cyclin-E cye-1
(eh10), rescues the cell division phenotype."
/evidence="ECO:0000269|PubMed:15247923"
SEQUENCE 709 AA; 79740 MW; AB5873D8C7FEDB0C CRC64;
MREDHSPRRN NTIENTLTEL LPNRLYFGCF PNPDAIDKSD KSVKKTCFIN INNKFHYEPF
YEDFGPWNLS VLYRLCVQVG KLLEVEEKRS RRVVLFCQDD GTGQYDKIRV NTAYVLGAYL
IIYQGFSADD AYLKVSSGET VKFVGFRDAS MGSPQYLLHL HDVLRGIEKA LKFGWLDFSD
FDYEEYEFYE RVENGDFNWI IPGKILSFCG PHNESREENG YPYHAPDVYF DYFRENKVST
IVRLNAKNYD ASKFTKAGFD HVDLFFIDGS TPSDEIMLKF IKVVDNTKGG VAVHCKAGLG
RTGTLIACWM MKEYGLTAGE CMGWLRVCRP GSVIGPQQPY LIEKQKFCWS LSQSNGVHLT
QNKEEKRNVR RLVNQVDDIN LGEERISPKS RENTRPNILR RRVQVQNGRS TAPVTIAPAG
TSESRRSTKP SRVVDETALD DQGRSQGDRL LQLKAKHQHE SETTSPNSSS SRRFVKSSTP
QMTVPSQAYL NRNREPIIVT PSKNGTSSGT SSRQLKTTPN GNVAYRTRNS SGNTTSTLTR
TGNESYRFHN SLFYEPASAV FPSMASRRSE TTRYLSPTTP IKPMSPSYTD GTSPRYKARL
RSENPIGSTT STPFSLQPQI TKCSLTAESK PPKRILSMPG TSKSTSSLKK IQVSRPRPYP
STGVRVELCA NGKSYDIRPR KEAHVIPGAG LAANTEALLG VCKLVNTLS


Related products :

Catalog number Product name Quantity
EIAAB06507 CDC2L,CDC2L5,CDC2-related protein kinase 5,CDK13,Cell division cycle 2-like protein kinase 5,Cell division protein kinase 13,CHED,Cholinesterase-related cell division controller,Cyclin-dependent kinas
EIAAB06505 Cdc2l5,CDC2-related protein kinase 5,Cdk13,Cell division cycle 2-like protein kinase 5,Cell division protein kinase 13,Cyclin-dependent kinase 13,Kiaa1791,Mouse,Mus musculus
EIAAB06506 Bos taurus,Bovine,CDC2L,CDC2L5,CDC2-related protein kinase 5,CDK13,Cell division cycle 2-like protein kinase 5,Cell division protein kinase 13,Cyclin-dependent kinase 13
EIAAB06521 Cdc2l6,CDC2-related protein kinase 6,Cdk19,Cell division cycle 2-like protein kinase 6,Cell division protein kinase 19,Cyclin-dependent kinase 19,Kiaa1028,Mouse,Mus musculus
EIAAB06502 Cdc2-related kinase, arginine_serine-rich,CDC2-related protein kinase 7,Cdk12,Cell division cycle 2-related protein kinase 7,Cell division protein kinase 12,Crk7,CrkRS,Crkrs,Cyclin-dependent kinase 12
EIAAB06503 Cdc2-related kinase, arginine_serine-rich,CDC2-related protein kinase 7,CDK12,Cell division cycle 2-related protein kinase 7,Cell division protein kinase 12,CRK7,CrkRS,CRKRS,Cyclin-dependent kinase 12
EIAAB06501 Cdc2-related kinase, arginine_serine-rich,CDC2-related protein kinase 7,Cdk12,Cell division cycle 2-related protein kinase 7,Cell division protein kinase 12,Crk7,CrkRS,Crkrs,Cyclin-dependent kinase 12
EIAAB33052 HCP,Hematopoietic cell protein-tyrosine phosphatase,Homo sapiens,Human,Protein-tyrosine phosphatase 1C,Protein-tyrosine phosphatase SHP-1,PTP1C,PTP-1C,PTPN6,SH-PTP1,Tyrosine-protein phosphatase non-re
EIAAB33119 Embryonic stem cell protein-tyrosine phosphatase,ES cell phosphatase,Esp,Osteotesticular protein-tyrosine phosphatase,OST-PTP,Ptprv,Rat,Rattus norvegicus,Receptor-type tyrosine-protein phosphatase V,R
EIAAB06450 Cdc5l,Cdc5-like protein,Cell division cycle 5-related protein,Pcdc5rp,Pombe Cdc5-related protein,Rat,Rattus norvegicus
EIAAB06448 Cdc5l,Cdc5-like protein,Cell division cycle 5-related protein,Kiaa0432,Mouse,Mus musculus
E10813m Rat ELISA Kit FOR Cell division cycle 5-related protein 96T
EIAAB06522 CDC2L6,CDC2-related protein kinase 6,CDK11,CDK19,Cell division cycle 2-like protein kinase 6,Cell division protein kinase 19,Cyclin-dependent kinase 11,Cyclin-dependent kinase 19,Death-preventing kina
EIAAB31094 Cdc91l1,Cell division cycle protein 91-like 1,GPI transamidase component PIG-U,Liver regeneration-related protein LRRGT00059,Phosphatidylinositol glycan anchor biosynthesis class U protein,Pigu,Protei
EIAAB33053 70Z-SHP,Hcp,Hcph,Hematopoietic cell protein-tyrosine phosphatase,Mouse,Mus musculus,Protein-tyrosine phosphatase 1C,Ptp1C,PTP-1C,Ptpn6,PTPTY-42,SHP-1,SH-PTP1,Tyrosine-protein phosphatase non-receptor
GWB-E29212 Anti- Cell division cycle 2-related protein kinase 7 Antibody
GWB-10F9BA Anti- Cell division cycle 7-related protein kinase Antibody
E1472r Human ELISA Kit FOR Cell division cycle 7-related protein kinase 96T
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.005 mg
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.01 mg
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.02 mg
PP-SHP1-020 SHP-1, Tyrosine-protein phosphatase non-receptor type 6, EC 3.1.3.48, Protein-tyrosine phosphatase 1C, PTP-1C, Hematopoietic cell protein-tyrosine phosphatase, SH-PTP1, Protein-tyrosine phosphatase SH 20
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.001 mg
EIAAB06449 CDC5L,Cdc5-like protein,Cell division cycle 5-like protein,Homo sapiens,Human,KIAA0432,PCDC5RP,Pombe cdc5-related protein
CSB-EL005023HU Human Cell division cycle 7-related protein kinase(CDC7) ELISA kit 96T
Pathways :
WP2199: Seed Development
WP1566: Citrate cycle (TCA cycle)
WP1654: gamma-Hexachlorocyclohexane degradation
WP2272: Pathogenic Escherichia coli infection
WP414: Cell Cycle and Cell Division
WP1714: Tyrosine metabolism
WP731: Sterol regulatory element binding protein related
WP1675: Nitrogen metabolism
WP190: Cell cycle
WP2324: AGE/RAGE pathway
WP45: G1 to S cell cycle control
WP959: G1 to S cell cycle control
WP1775: Cell Cycle Checkpoints
WP76: TCA Cycle
WP1792: Cell Cycle, Mitotic
WP346: Protein Modifications
WP1685: Peptidoglycan biosynthesis
WP1049: G Protein Signaling Pathways
WP1624: Bacterial secretion system
WP1083: Cell cycle
WP1650: Fluorobenzoate degradation
WP35: G Protein Signaling Pathways
WP813: G Protein Signaling Pathways
WP1393: Cell cycle
WP1690: Propanoate metabolism

Related Genes :
[cdc-14 C17G10.4] Tyrosine-protein phosphatase cdc-14 (EC 3.1.3.48) (Cell division cycle-related protein 14)
[CDC14A] Dual specificity protein phosphatase CDC14A (EC 3.1.3.16) (EC 3.1.3.48) (CDC14 cell division cycle 14 homolog A)
[clp1 flp1 SPAC1782.09c] Tyrosine-protein phosphatase CDC14 homolog (EC 3.1.3.48) (CDC fourteen-like phosphatase 1)
[ppnP yaiE yaiE_1 yaiE_2 A6581_06820 A6592_08565 A6V01_02400 A8C65_08910 A9819_01890 A9P13_20020 A9R57_08485 A9X72_19070 AC067_13660 AC789_1c03900 ACN002_0406 ACN68_10320 ACN81_25005 ACU57_12035 ACU90_20960 AM270_02350 AM446_21575 AM464_18935 AM465_24670 AMK83_08820 AML35_16935 APT94_15240 APU18_24510 ARC77_21605 AU473_24575 AUQ13_18550 AUS26_08265 AW059_14025 AWB10_19430 AWE53_023695 AWF59_002255 AWG78_005920 AZZ83_000156 B6V57_02070 B7C53_19905 B9N33_08655 B9T59_05995 BANRA_00817 BANRA_00925 BANRA_02015 BANRA_03594 BB545_15535 BE963_16095 BEN53_04105 BER14_23410 BFD68_18150 BHF03_17705 BHS81_02405 BHS87_02130 BIQ87_02175 BIU72_03345 BIZ41_26355 BJJ90_20310 BK248_04610 BK292_14635 BK296_16405 BK373_01320 BK375_26975 BK383_14985 BMA87_04900 BMT91_05310 BN17_01951 BOH76_16090 BON63_11530 BON65_18745 BON66_09075 BON69_11595 BON72_15085 BON75_11450 BON76_23825 BON83_20655 BON86_03800 BON87_15370 BON91_23895 BON92_15465 BON94_14845 BON95_06500 BON96_22295 BON98_18895 BTQ04_02855 BTQ06_17790 BUE81_15520 BvCms12BK_04795 BvCms2454_01767 BvCms28BK_00703 BvCms35BK_00554 BvCmsC61A_02990 BvCmsHHP001_01952 BvCmsHHP019_02594 BvCmsHHP019_02735 BvCmsHHP056_01410 BvCmsKKP036_04281 BvCmsKKP061_04019 BvCmsKSNP073_05624 BvCmsKSNP081_00030 BvCmsKSNP120_04274 BvCmsKSP011_04945 BvCmsKSP024_04930 BvCmsKSP045_04772 BvCmsKSP058_04860 BvCmsKSP067_05191 BvCmsKSP076_04759 BvCmsNSP006_01281 BvCmsNSP007_00849 BvCmsNSP047_03416 BvCmsNSP072_00997 BvCmsOUP014_01108 BvCmsSINP011_02573 BvCmsSINP022_02885 BvCmsSIP019_03625 BvCmsSIP024_01003 BvCmsSIP044_01545 BVL39_00880 BW690_06575 BWI89_12535 BWP17_02145 BXT93_00165 BZL31_10725 BZL69_16805 C2M16_02670 C2U48_08110 C4K41_08090 C4M78_16865 C5715_13595 C5F72_20070 C5F73_09375 C5N07_12740 C5P01_16305 C5P44_19530 C6669_02755 C7235_18880 C7B02_04545 C7B06_13385 C7B07_15195 C7B08_06180 C7B18_00985 C9114_16640 C9160_00550 C9201_03800 C9306_02820 C9342_10250 C9E25_04580 C9E67_23765 C9Z03_06575 C9Z23_12315 C9Z28_08265 C9Z37_04640 C9Z68_20485 C9Z70_09610 C9Z78_08360 CA593_01185 CCZ14_02440 CCZ17_04120 CDC27_00860 CDL37_09465 CG692_05055 CI641_017850 CI693_15730 CI694_14320 CJU64_02110 CO706_24355 COD30_16055 COD46_04855 CQP61_20925 CR538_19495 CR539_06140 CRD98_01665 CRE06_07890 CRM83_13790 CRT43_02180 CT146_15735 CUB99_06570 CV83915_01183 CVH05_20630 CWS33_22875 D0X26_07420 D1912_23295 D2184_11515 D2185_12065 D2188_07740 D3821_12900 D3822_22465 D3C88_28950 D3O91_15305 D3Y67_14350 D4011_06560 D4023_06905 D4074_04630 D4660_05035 D4L91_04625 D4M06_05545 D4M76_11590 D4U49_03050 D4U85_07085 D4V08_07680 D5H35_11765 D5I97_03520 D6004_10480 D6C36_05740 D6D43_08420 D6T60_09300 D6X63_13510 D6X76_06760 D7K33_06120 D7K63_09055 D7K66_05505 D7Y10_05925 D7Z75_05315 D8Y65_05290 D9610_20040 D9C99_17255 D9D20_11505 D9D31_21970 D9D33_06060 D9D43_14830 D9D94_14580 D9E34_09525 D9E49_06955 D9E73_13115 D9F32_03890 D9F87_10325 D9G11_17940 D9G42_13940 D9G48_15840 D9G69_10950 D9G95_10030 D9H53_17415 D9H68_03320 D9H70_06445 D9H94_24405 D9I18_05395 D9I20_07245 D9I37_10805 D9I87_03310 D9I88_07660 D9I97_02265 D9J03_17400 D9J11_02150 D9J44_05830 D9J46_05500 D9J52_12125 D9J60_08565 D9J61_02635 D9K02_04260 D9K48_11575 D9K54_20845 D9L89_06360 D9L99_04375 D9X77_04435 D9X97_05410 D9Z28_01965 DAH18_14975 DAH23_10455 DAH30_15925 DAH34_21345 DAH37_05240 DD762_07680 DEN86_05080 DEN89_14495 DEO04_04545 DEO20_14385 DIV22_26285 DJ503_01820 DL455_04445 DL530_07575 DL545_19130 DL705_16435 DL800_03885 DL979_15710 DLT82_12465 DLU82_01595 DLX40_16565 DM102_12740 DM129_06110 DM155_09525 DM962_06005 DMI04_05340 DMI53_06710 DMO02_05340 DMZ30_04890 DMZ50_06340 DN627_04525 DN660_05650 DN703_04290 DN808_18120 DNB37_05440 DNC98_06510 DND16_02325 DND79_04070 DNI21_04080 DNJ62_06830 DNK12_05040 DNQ45_00335 DNR35_00475 DNR41_17405 DOE35_04920 DOS18_04715 DOT59_02705 DOT81_06465 DOU81_04760 DOY22_07805 DOY56_05925 DOY61_02085 DOY67_05265 DP258_05110 DP277_07535 DQF57_07675 DQG35_06310 DQO13_05500 DQP61_12090 DRP48_07670 DRW19_06400 DS143_21555 DS721_06100 DS732_06920 DS966_18475 DT034_10500 DTL43_07415 DTL90_10740 DTM10_06080 DTM45_10960 DTZ20_03380 DU321_19460 DU333_14985 DW236_15815 DWB25_19225 DXT69_08115 DXT71_02970 DXT73_01860 DXX80_018650 E0I42_07410 E0L04_02150 E0L12_02445 E2114_20640 E2115_06350 E2119_01725 E2127_09375 E2128_04435 E2129_13975 E2134_12225 E2135_01410 E2855_00540 E2863_00426 E4K53_09880 E4K55_09545 E4K61_11255 E5P24_15620 E5P28_11315 E5S34_07545 E5S38_06765 E5S42_13060 E5S44_09845 E5S56_05125 E5S58_11035 E5S61_09810 E5S62_19990 EA167_08615 EA174_09235 EA184_12770 EA191_05310 EA203_10735 EA211_00925 EA213_08335 EA214_19270 EA219_17055 EA225_09190 EA233_12800 EA239_15730 EA250_12110 EA433_19520 EA435_05820 EA834_11650 EAI42_35435 EAI46_25725 EAI46_25840 EAI52_02950 EAM59_14455 EAN77_07940 EAX79_06830 EB509_06855 EB510_01625 EB515_09345 EB525_RS00545 EBJ06_07125 EBM08_07705 EBP16_12520 EC1094V2_3464 EC3234A_4c00610 EC382_12595 EC95NR1_04612 ECs0441 ECTO124_03817 ECTO6_03708 ED225_07600 ED600_06320 ED611_06650 ED648_16775 ED903_13725 ED944_09580 EEA45_02855 EEP23_01045 EF082_13590 EF173_10565 EG599_13105 EG808_04255 EGT48_21390 EGU87_05200 EH412_12630 EHD63_07610 EHD79_03470 EHH55_15815 EHJ36_08465 EHJ66_07060 EHV81_03360 EHV90_10850 EHW09_13270 EHX09_04730 EI021_16245 EI032_07550 EI041_08145 EIA21_11810 EIZ93_00830 EJC75_24145 EKI52_09170 EL75_3359 EL79_3454 EL80_3408 ELT17_22260 ELT22_04045 ELT23_00125 ELT31_00280 ELT33_03015 ELT48_00735 ELT49_21480 ELT58_21305 ELU82_03335 ELU85_08960 ELU96_05805 ELV00_13055 ELV08_00785 ELV13_00555 ELV15_22680 ELV22_01630 ELV24_16525 ELV28_08410 ELX56_03900 ELX61_20790 ELX68_02065 ELX69_19550 ELX70_07125 ELX76_05850 ELX79_24270 ELX83_01445 ELX96_14305 ELY05_09885 ELY23_04665 ELY24_07180 ELY32_22740 ELY41_15435 ELY48_07355 ELY50_04295 EO241_13835 EPS70_14865 EPS76_10515 EPS91_09770 EPS94_16700 EPT01_06355 EQ820_00745 EQ823_11615 EQ825_18070 EQ830_03660 ERS085362_02676 ERS085366_04179 ERS085374_02377 ERS085379_01215 ERS085383_01024 ERS085386_01096 ERS085404_01742 ERS085406_02227 ERS150873_01858 EST51_18990 ETECE1373_03601 ETECE1441_03612 ETECE1649_03506 ETECE1779_04258 ETECE36_04584 ETECE925_03600 EVY14_00050 EWK56_10245 EXM29_24150 ExPECSC038_04895 ExPECSC065_04439 EXX06_12400 EXX13_09665 EXX23_09965 EXX24_01870 EXX53_07630 EXX55_11875 EXX71_12170 EXX87_11565 EYD11_17450 EYV18_10135 EYX82_01145 EYY27_15550 EYY34_27625 EYY78_10095 F0L67_19465 F1E19_02455 F6T45_22350 F6T51_06360 F6V70_05450 F7F11_06850 F7F23_13355 F7F26_08530 F7F56_11190 F7G03_09695 F7O57_06490 F9B07_11235 F9X20_010625 F9X20_10705 FAF34_030290 FE846_08235 FKO60_24460 FNJ67_20330 FNJ69_23475 FORC82_3666 FPI65_02250 FQ021_04720 FQ915_14565 FQU83_20855 FRV13_03860 FTV90_10360 FTV92_11870 FTV93_12360 FV250_14320 FV293_06120 FV295_17245 FV438_20585 FVA71_19985 FWK02_29295 FZC17_02065 FZN26_02330 FZN30_08825 G3565_02860 G4280_18620 G5616_16275 G5668_11855 G5670_13140 G5680_11755 G5688_07395 G5696_10795 G6Z99_23355 G9448_08700 G9P49_16830 G9P50_16250 GE057_12200 GE087_02515 GE096_15955 GE400_02540 GE558_09695 GFU47_21615 GFY48_03475 GHD50_02110 GIJ01_19765 GIY13_13165 GIY19_15475 GJ11_02375 GJD97_21645 GKE29_12130 GKE58_10855 GKE60_09410 GKE79_09230 GKE87_01825 GKF34_16490 GKF39_01885 GKF52_17565 GKF74_01460 GKF86_04910 GKF89_04055 GKG12_02940 GNZ02_03615 GNZ05_01665 GP650_16700 GP662_13045 GP666_10645 GP698_13660 GP711_02810 GP720_05730 GP935_14810 GP945_18805 GP946_18990 GP954_12950 GP979_17585 GQE22_09325 GQE33_07115 GQE34_00765 GQE36_18000 GQE42_04900 GQE64_07505 GQE87_15550 GQF59_00790 GQM04_16295 GQM06_17115 GQM09_10135 GQM10_05275 GQM13_16755 GQM17_10365 GQM18_17190 GQM28_05335 GQN24_05490 GRC73_12510 GRW02_05020 GRW05_15575 GRW30_07965 GRW57_16360 GRW80_21245 GRW81_04110 GUB08_22335 GUB85_11880 GUB91_14510 GUB95_14180 GUC01_07480 GUC12_15000 GUI16_08025 GUI33_03675 GXC14_20220 H4P50_19265 H4P51_19115 H5C68_16910 H5C80_22515 HCR07_11915 HF065_000755 HF523_01165 HFD31_001236 HFD39_002504 HFD59_003103 HFD69_003066 HFU80_001346 HGR17_22385 HGR87_01460 HGR88_06440 HGS97_11820 HGT58_04135 HH117_07870 HH456_002645 HH707_000108 HH814_000579 HH830_001792 HHA77_001423 HHG54_000763 HHH24_000946 HHH97_002377 HHJ41_01370 HHJ44_22155 HHJ51_05025 HI055_001796 HI083_000480 HIB31_002797 HIN76_001080 HIO03_001580 HIO61_000590 HIQ74_001213 HIQ82_002038 HIR91_000876 HIT56_001577 HIT59_002003 HIZ44_002483 HIZ62_001433 HJ359_001771 HJ411_000554 HJ802_001358 HJI79_003357 HJL93_002730 HJM41_000592 HJM89_001896 HJN45_001169 HJO44_000019 HJO53_003212 HJQ03_003089 HJR58_002219 HJR60_001095 HJR92_002545 HJS12_001242 HJS53_002270 HJT66_002048 HJT90_002082 HJU54_001570 HJV81_000744 HK427_001468 HKA14_002869 HKA45_002554 HKA57_001676 HKC58_001279 HL152_08835 HL186_02490 HL563_20960 HLI97_000112 HLQ75_07955 HLQ92_12990 HLT96_03035 HLU13_05400 HLU98_04605 HLY53_21035 HLZ85_06695 HmCms169_03669 HmCms184_01874 HmCmsJML074_04353 HmCmsJML079_00649 HmCmsJML146_03132 HmCmsJML204_02343 HMG20_09930 HMG24_12660 HMG27_12270 HMG35_19725 HMP86_22290 HMPREF3040_03387 HMQ05_07470 HMT01_08840 HMT08_08320 HMT08_28135 HMW26_10275 HMW26_27920 HNC38_21355 HNC40_07205 HNC59_10160 HNC73_14325 HNC73_28105 HNC75_03340 HNC80_02630 HNC88_10750 HNC94_01805 HNC99_09055 HND23_10890 HNN86_05540 HNO03_09675 HNO08_21040 HNV44_01815 HNX16_02485 HNX34_02410 HNY58_07155 HP431_07725 HPE39_05435 HPE49_20435 HPE52_15660 HPM96_04240 HR075_18950 HS093_08480 HV005_16510 HV021_17015 HV022_17950 HV055_18220 HV065_00215 HV068_18270 HV098_18955 HV108_19500 HV109_18115 HV131_23750 HV149_18435 HV152_17755 HV156_07825 HV159_09785 HV168_09465 HV188_05655 HV226_23340 HV244_16550 HV297_16755 HV303_20415 HV348_18230 HVV38_09665 HVV39_18775 HVV53_22620 HVV73_17755 HVV78_05095 HVV92_19015 HVW09_04615 HVW11_04845 HVW22_00965 HVW37_18825 HVW43_10265 HVW44_14930 HVW45_17890 HVW59_08530 HVW60_17400 HVW76_17030 HVW90_08090 HVW93_05045 HVW95_10270 HVW98_04760 HVX17_19490 HVX22_17445 HVX24_17055 HVX30_05390 HVX33_08680 HVX51_18435 HVX60_09555 HVX73_17865 HVX96_09065 HVY01_17550 HVY77_19945 HVY79_05095 HVY93_17995 HVZ20_05415 HVZ21_18085 HVZ24_17385 HVZ42_18115 HVZ44_17970 HVZ47_04860 HVZ53_18680 HVZ62_09000 HVZ71_18990 HW43_05570 HWQ66_23340 HX136_19525 HXS78_17140 HZT35_11660 IB283_04800 IEM32_07330 MJ49_04490 MS8345_00396 NCTC10082_01078 NCTC10089_03910 NCTC10418_05682 NCTC10429_03762 NCTC10764_05371 NCTC10767_04209 NCTC10865_04787 NCTC10963_03206 NCTC11022_05137 NCTC11126_00022 NCTC11181_01145 NCTC11341_03896 NCTC12950_04180 NCTC13127_05156 NCTC13216_02895 NCTC13846_03688 NCTC7922_06246 NCTC7927_04270 NCTC8009_07014 NCTC8179_01642 NCTC8450_01367 NCTC8500_04283 NCTC8621_03984 NCTC8622_02997 NCTC8959_05017 NCTC8960_01314 NCTC8985_02798 NCTC9001_00537 NCTC9007_00270 NCTC9036_03840 NCTC9044_03501 NCTC9045_04434 NCTC9050_01764 NCTC9055_00703 NCTC9058_03120 NCTC9062_04466 NCTC9075_05103 NCTC9077_04792 NCTC9081_02496 NCTC9111_03977 NCTC9117_04804 NCTC9119_03997 NCTC9434_02812 NCTC9701_04128 NCTC9702_04480 NCTC9703_03222 NCTC9706_01114 NCTC9777_00174 NCTC9969_04032 PGD_02920 PU06_02955 RG28_02910 RK56_026705 RX35_02064 SAMEA3472043_02682 SAMEA3472044_00466 SAMEA3472047_02102 SAMEA3472055_02163 SAMEA3472056_03633 SAMEA3472070_02281 SAMEA3472080_01810 SAMEA3472090_01813 SAMEA3472108_01855 SAMEA3472110_00729 SAMEA3472112_02965 SAMEA3472114_01257 SAMEA3472147_04902 SAMEA3484427_03543 SAMEA3484429_01888 SAMEA3484434_01710 SAMEA3485101_03989 SAMEA3752372_02749 SAMEA3752553_00287 SAMEA3752557_00215 SAMEA3752559_02897 SAMEA3752620_00785 SAMEA3753064_01236 SAMEA3753097_00513 SAMEA3753164_00218 SAMEA3753290_01725 SAMEA3753300_00458 SK85_00418 SY51_02060 TUM18780_32860 U14A_00395 UC41_24265 UN86_08900 UN91_18725 WP2S18E08_35360 WP4S17E03_35290 WP4S17E08_35200 WP4S18E07_34480 WP4S18E08_34230 WP5S18E09_34520 WP7S17E01_36800 WP7S17E04_33320 WP7S18E09_37190 WQ89_01420 WR15_04360 YDC107_3656] Pyrimidine/purine nucleoside phosphorylase (EC 2.4.2.1) (EC 2.4.2.2) (Adenosine phosphorylase) (Cytidine phosphorylase) (Guanosine phosphorylase) (EC 2.4.2.15) (Inosine phosphorylase) (Thymidine phosphorylase) (EC 2.4.2.4) (Uridine phosphorylase) (EC 2.4.2.3) (Xanthosine phosphorylase)
[cdc-48.1 C06A1.1] Transitional endoplasmic reticulum ATPase homolog 1 (EC 3.6.4.6) (Cell division cycle-related protein 48.1) (p97/CDC48 homolog 1)
[ORF1ab orf1ab] 2'-O-methyltransferase (EC 2.7.7.48) (EC 3.4.19.12) (EC 3.4.22.69) (EC 3.6.4.12) (EC 3.6.4.13) (3C-like proteinase) (Growth factor-like peptide) (Guanine-N7 methyltransferase) (Helicase) (Host translation inhibitor nsp1) (Leader protein) (NendoU) (Non-structural protein 10) (Non-structural protein 2) (Non-structural protein 3) (Non-structural protein 4) (Non-structural protein 6) (Non-structural protein 7) (Non-structural protein 8) (Non-structural protein 9) (ORF1ab polyprotein) (Papain-like proteinase) (RNA-directed RNA polymerase) (Replicase polyprotein 1ab) (Uridylate-specific endoribonuclease) (p65 homolog)
[ORF1ab orf1ab] 2'-O-methyltransferase (EC 2.7.7.48) (EC 3.4.19.12) (EC 3.4.22.69) (EC 3.6.4.12) (EC 3.6.4.13) (3C-like proteinase) (Growth factor-like peptide) (Guanine-N7 methyltransferase) (Helicase) (Host translation inhibitor nsp1) (Leader protein) (NendoU) (Non-structural protein 10) (Non-structural protein 2) (Non-structural protein 3) (Non-structural protein 4) (Non-structural protein 6) (Non-structural protein 7) (Non-structural protein 8) (Non-structural protein 9) (ORF1ab polyprotein) (Papain-like proteinase) (RNA-directed RNA polymerase) (Replicase polyprotein 1ab) (Uridylate-specific endoribonuclease) (p65 homolog)
[CDK13 CDC2L CDC2L5 CHED KIAA1791] Cyclin-dependent kinase 13 (EC 2.7.11.22) (EC 2.7.11.23) (CDC2-related protein kinase 5) (Cell division cycle 2-like protein kinase 5) (Cell division protein kinase 13) (hCDK13) (Cholinesterase-related cell division controller)
[cdc-48.2 C41C4.8] Transitional endoplasmic reticulum ATPase homolog 2 (EC 3.6.4.6) (Cell division cycle-related protein 48.2) (p97/CDC48 homolog 2)
[cdc-48.3 K04G2.3] ATPase family protein 2 homolog (EC 3.6.4.10) (Cell division cycle-related protein 48.3)
[CDC48 YDL126C] Cell division control protein 48 (EC 3.6.4.6) (Cell division cycle protein 48) (Transitional endoplasmic reticulum ATPase homolog)
[CDC7 CDC7L1] Cell division cycle 7-related protein kinase (CDC7-related kinase) (HsCdc7) (huCdc7) (EC 2.7.11.1)
[Cdc7 Cdc7l1] Cell division cycle 7-related protein kinase (CDC7-related kinase) (muCdc7) (EC 2.7.11.1)
[glmU glmU_2 glmU_3 A6581_09665 A6592_18320 A6V01_13950 A9819_21425 A9X72_25295 AC789_1c41180 ACN002_3832 ACN68_12820 ACN81_06555 ACU57_03260 ACU90_00355 AM270_09150 AM464_11925 AMK83_17395 APU18_07655 AU473_02270 AUQ13_19405 AUS26_01175 AW059_18705 AWB10_26355 B9T59_13030 BANRA_02393 BANRA_03222 BANRA_04603 BANRA_04796 BB545_21555 BHS81_22260 BIQ87_21230 BK292_20095 BK296_18095 BK373_18215 BK383_23375 BMA87_22890 BMT91_10610 BN17_36841 BOH76_10130 BON63_19095 BON65_14635 BON66_26875 BON69_17430 BON72_01080 BON75_22025 BON76_09155 BON86_07715 BON94_01565 BON95_10825 BON98_14770 BTQ04_25600 BTQ06_19350 BUE81_18190 BvCms12BK_01939 BvCms2454_00289 BvCms28BK_02481 BvCms35BK_04109 BvCmsC61A_04423 BvCmsHHP001_00461 BvCmsHHP019_05382 BvCmsHHP056_00162 BvCmsKSNP073_00085 BvCmsKSNP081_05063 BvCmsKSNP120_03387 BvCmsKSP026_00189 BvCmsKSP058_02752 BvCmsKSP076_00416 BvCmsNSP007_04536 BvCmsNSP072_01195 BvCmsOUP014_03354 BvCmsSINP011_01249 BvCmsSINP022_02716 BvCmsSIP019_01735 BvCmsSIP044_00507 BVL39_06835 BWI89_19050 BWP17_17365 BZL31_21455 BZL69_24160 C2U48_14295 C5F72_00060 C5F73_00060 C5N07_23115 C5P01_14420 C6669_09005 C7235_25120 C7B02_15500 C7B06_18155 C7B07_18515 C7B08_22590 C7B18_25025 C9114_08815 C9160_23555 C9201_16915 C9306_10260 C9E25_06495 C9E67_00060 C9Z03_01175 C9Z23_09530 C9Z28_20325 C9Z70_17945 CA593_07340 CDC27_20200 CDL37_07540 CG692_21420 CI641_012005 CI693_04705 CI694_10045 CJU64_22275 COD30_14500 COD46_05155 CQP61_27670 CR538_25580 CRD98_06320 CV83915_02333 CVH05_22850 CWS33_22530 D0X26_21550 D2185_10415 D2188_17020 D3821_26085 D3O91_06095 D3Y67_00150 D4011_10215 D4023_13815 D4074_11120 D4660_11630 D4U85_12095 D5H35_02930 D5I97_20190 D6004_02830 D6D43_12490 D6T60_12795 D6X63_19220 D7Z75_18885 D8Y65_22385 D9610_01730 D9C99_01700 D9D20_15040 D9D44_13525 D9E35_19375 D9F32_14970 D9F87_23775 D9G69_19265 D9G95_12695 D9H53_20670 D9H68_12075 D9I18_08010 D9I20_20130 D9I97_18895 D9J03_09380 D9J11_15830 D9J44_15575 D9J52_19550 D9J60_09800 D9K02_23495 D9K48_06035 D9X77_10520 DAH18_20310 DAH23_18115 DAH34_09145 DAH37_15330 DEO20_16655 DIV22_14650 DJ503_21245 DL455_13595 DL530_06485 DL545_25055 DL800_26260 DL979_08865 DLT82_05615 DLU82_11180 DLX40_10770 DM155_02865 DMI04_10230 DMI53_10520 DMO02_11815 DMZ30_15835 DN627_09955 DN660_14485 DN703_10795 DN808_15490 DNC98_03385 DND16_22260 DND79_13790 DNI21_17640 DNK12_11365 DNR35_18400 DOE35_09715 DOT81_11385 DOU81_08805 DOY22_14970 DOY61_14995 DOY67_09025 DP258_23900 DP277_10655 DQF57_16195 DQG35_23865 DQO13_14575 DRP48_11730 DRW19_13710 DS143_08295 DS732_00190 DS966_11425 DT034_13780 DTL43_15410 DTM10_15365 DTM45_17565 DU321_22570 DXT69_23215 DXT73_04785 DXX80_012740 E0I42_12515 E0L12_21515 E2119_14490 E2127_21255 E2128_05705 E2129_08000 E2134_19675 E2855_04733 E2863_04349 E4K53_19020 E4K55_18890 E4K61_17290 E5P24_15945 E5S34_11730 E5S56_16310 E5S58_07665 EA174_13265 EA211_18840 EA213_15945 EA225_17635 EA233_16295 EAI42_11865 EAI52_06475 EAM59_18970 EAN77_19450 EAX79_08850 EB510_22210 EB525_RS02170 EBM08_01690 EBP16_13375 EC1094V2_4567 EC3234A_68c00720 EC95NR1_03169 ECs4672 ECTO6_04785 ED600_19990 ED607_18790 ED648_17265 EEP23_14805 EF082_06915 EF173_14735 EG599_08800 EG808_05695 EGU87_10050 EH412_16365 EHH55_27400 EHJ36_17225 EHV81_10495 EHV90_11245 EHW09_18960 EI021_09265 EI032_05065 EI041_19855 EIZ93_14035 EJC75_18290 EKI52_15300 EL75_4440 EL79_4691 EL80_4599 ELT17_19030 ELT31_15890 ELT33_18295 ELV08_24380 ELY05_18395 EO241_24425 EPT01_04090 EQ830_20875 ERS085362_04864 ERS085374_04669 ERS085379_02377 ERS085383_02606 ERS085386_04235 ERS085404_04398 ERS150873_02957 ETECE1373_04734 ETECE1441_04799 ETECE1649_04653 ETECE1779_05443 ETECE36_05685 ETECE925_04771 EWK56_18720 EXM29_08345 ExPECSC038_00225 EXX06_15315 EXX23_21160 EXX53_13915 EXX55_17010 EXX71_21730 EXX87_24160 EYD11_23115 EYV18_08960 EYX82_15185 EYY78_20480 F0L67_11240 F6T51_22160 F6V70_17480 F7F23_11745 F7F26_17865 F7F56_07415 F7G03_21905 F9X20_004425 F9X20_04465 FE846_12035 FORC82_4802 FQ915_15520 FRV13_17495 FV250_18855 FV293_15990 FV438_15575 FZN30_24405 G5616_15710 G5632_18830 G5668_15860 G5670_11585 G5680_11065 G5688_20670 G9448_14800 G9P49_22345 G9P50_21335 GE558_15175 GFY48_18445 GHD50_18595 GIJ01_05120 GIY13_14360 GIY19_17475 GJD97_27325 GKE29_14685 GKE58_14245 GKE60_14955 GKE79_14610 GKE87_10475 GKF39_21125 GKF74_19015 GKF86_20510 GKF89_22110 GKG12_12810 GNZ02_16475 GNZ05_16000 GP650_13870 GP662_07520 GP666_22530 GP698_15515 GP935_23805 GP945_03305 GP946_02095 GQE22_20215 GQE33_12345 GQE34_04215 GQE42_18075 GQE64_10965 GQE87_20140 GQF59_16680 GQM04_04790 GQM09_08985 GQM10_13950 GQM13_19765 GQM17_19245 GQM28_11695 GQN24_11540 GRW02_11630 GRW05_11280 GRW30_13170 GRW80_05400 GRW81_18060 GUB85_16045 GUB91_00910 GUB95_16790 GUC01_19650 GUC12_04660 GUI16_16455 H4P50_25950 H4P51_25795 H5C80_03560 HCR07_17560 HF065_002335 HF523_12440 HFD31_002955 HFD39_002309 HFD59_002430 HFD69_001921 HFU80_002196 HGT58_18390 HH707_001732 HHH24_004872 HHH97_003851 HHJ51_11025 HI083_003648 HIO03_002168 HIO61_002256 HIQ82_001633 HIT56_002457 HIT59_001605 HIZ44_003400 HJ359_003611 HJI79_003637 HJM89_004215 HJN45_004458 HJO53_003568 HJR58_002954 HJR60_001489 HJR92_003444 HJT90_003091 HJU54_003636 HJV81_002158 HKA14_004088 HKA45_003625 HKA57_004078 HKC58_000815 HLQ75_21315 HLQ92_13435 HLT96_15820 HLU13_16275 HLU98_17175 HLY53_21770 HmCmsJML079_01069 HmCmsJML204_03516 HMG20_02280 HMG24_11675 HMG27_10205 HMG35_10855 HMPREF3040_01843 HMQ05_19030 HMT01_07800 HNC38_23280 HNC40_10045 HNC59_18745 HNC59_28610 HNC75_13275 HNC94_06395 HNC99_14760 HNC99_28905 HND23_09795 HNN81_19765 HNN86_08900 HNO03_06355 HNO08_20235 HNV44_14255 HNY58_11695 HP431_13730 HPE52_23120 HS093_13845 HV005_21500 HV022_23560 HV065_18290 HV068_24330 HV098_25415 HV109_23905 HV149_23870 HV156_13535 HV159_16080 HV168_15140 HV188_24905 HV226_05020 HV297_22690 HVV38_16250 HVV53_16375 HVV70_22135 HVV73_23375 HVV78_23430 HVV92_25250 HVW09_24425 HVW11_10440 HVW37_24360 HVW43_16340 HVW45_23885 HVW59_14195 HVW60_22920 HVW76_22355 HVW93_22655 HVW98_23160 HVX22_23355 HVX24_22685 HVX30_24635 HVX33_14075 HVX51_24290 HVX60_15795 HVX73_23745 HVX96_14645 HVY01_23185 HVY77_25805 HVY93_23625 HVZ24_22580 HVZ42_23720 HVZ47_22995 HVZ53_24255 HVZ62_14760 HVZ71_25230 HWQ66_05340 HX136_24900 HXS78_23050 HZT35_17690 IEM32_01455 MJ49_11065 NCTC10429_00468 NCTC10865_06239 NCTC10963_05103 NCTC10974_05712 NCTC11022_03976 NCTC11126_01877 NCTC11181_02288 NCTC13148_04066 NCTC13216_01836 NCTC8179_05408 NCTC8500_05668 NCTC8960_02620 NCTC9036_04918 NCTC9044_01984 NCTC9045_05866 NCTC9055_01938 NCTC9058_01876 NCTC9062_03137 NCTC9075_06811 NCTC9077_06282 NCTC9111_05234 NCTC9119_05331 NCTC9701_05275 NCTC9703_04497 NCTC9777_01408 NCTC9969_05244 PU06_20985 RG28_23955 RX35_03583 SAMEA3472043_04164 SAMEA3472044_00557 SAMEA3472047_02983 SAMEA3472055_04848 SAMEA3472070_05221 SAMEA3472080_03401 SAMEA3472108_02432 SAMEA3472114_05020 SAMEA3472147_03715 SAMEA3484427_03578 SAMEA3484429_03579 SAMEA3752557_01236 SAMEA3752559_04751 SAMEA3753064_05409 SAMEA3753097_00976 SAMEA3753290_05405 SAMEA3753300_04363 SK85_04060 UN91_09875 WP2S18E08_47930 WP4S18E08_45600 WP7S17E01_47990 WP7S17E04_43880 WQ89_11260] Bifunctional protein GlmU [Includes: UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) (N-acetylglucosamine-1-phosphate uridyltransferase); Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)]
[CDK9 CDC2L4 TAK] Cyclin-dependent kinase 9 (EC 2.7.11.22) (EC 2.7.11.23) (C-2K) (Cell division cycle 2-like protein kinase 4) (Cell division protein kinase 9) (Serine/threonine-protein kinase PITALRE) (Tat-associated kinase complex catalytic subunit)
[orf1ab ORF1ab] 2'-O-methyltransferase (EC 2.7.7.48) (EC 3.4.19.12) (EC 3.4.22.69) (EC 3.6.4.12) (EC 3.6.4.13) (3C-like proteinase) (Growth factor-like peptide) (Guanine-N7 methyltransferase) (Helicase) (Host translation inhibitor nsp1) (Leader protein) (NendoU) (Non-structural protein 10) (Non-structural protein 2) (Non-structural protein 3) (Non-structural protein 4) (Non-structural protein 6) (Non-structural protein 7) (Non-structural protein 8) (Non-structural protein 9) (ORF1ab polyprotein) (Papain-like proteinase) (RNA-directed RNA polymerase) (Replicase polyprotein 1ab) (Uridylate-specific endoribonuclease) (p65 homolog)
[Ptpn6 Hcp Hcph Ptp1C] Tyrosine-protein phosphatase non-receptor type 6 (EC 3.1.3.48) (70Z-SHP) (Hematopoietic cell protein-tyrosine phosphatase) (PTPTY-42) (Protein-tyrosine phosphatase 1C) (PTP-1C) (SH-PTP1) (SHP-1)
[nnrE nnrD A3S59_13690 A3T49_17335 A3T75_18530 A3U47_10225 A3U54_09275 A3U78_16085 A3V15_17065 A3V28_15960 A3W22_12930 A4M41_16600 A5970_12510 A6267_12745 A6T07_15280 A7C55_07720 A7H28_15850 A9591_13875 A9C99_18275 A9S47_10990 A9S88_14770 A9X19_06535 AAA56_09530 AAB90_13650 ABA14_13890 ABP10_07270 ABQ42_14075 ACG84_16195 ACM10_17980 ACT92_14320 ACT96_14390 ADR00_04465 ADS36_15285 AGN17_13430 AGP91_11565 AH461_16240 AHV90_18155 AIE92_07590 AKX49_10100 AL461_13480 ALZ46_15575 AM316_12625 AM321_08345 AM525_15220 AN727_01255 AO198_17430 AO799_11345 AOL87_17660 AOL88_17815 AOU74_07580 APN68_15490 APO02_17555 AQ518_14155 AR267_17095 AS882_13920 ASN84_12635 ASV75_18200 AU760_14795 AU775_10415 AVB14_10850 AVI06_14750 B0A21_09265 B0F61_13105 B1868_15980 B4P96_15895 B4W84_18200 B4Z10_18285 B5C64_17865 B6339_13635 B6379_12905 B6396_17560 B6M83_15130 B6N80_13955 B7136_14330 B7900_15880 B7919_12405 B7C82_16710 B7J34_05280 B7M41_18735 B7Q10_20390 B8V98_15175 B8Y89_12815 B8Y98_13185 B8Z45_12040 B9176_15685 B9672_11375 B9673_18235 B9727_12095 B9756_14295 B9H85_18105 B9I48_18045 B9P12_16640 BB088_18985 BBL75_13960 BCP76_14830 BCP85_15340 BCP91_17540 BH227_14585 BIB62_15765 BJO06_15955 BJO39_11850 BK099_19165 BK864_11970 BKF55_14350 BKO29_15730 BSD53_18530 BSD63_15630 BTC31_13980 BXJ37_18690 BZ670_13760 BZ697_16830 BZ722_12720 BZ742_17225 BZ751_18150 BZ759_12840 BZ809_15460 BZ833_13870 BZ881_13655 BZ894_14830 BZ908_18660 BZ939_15625 BZ955_18375 BZ980_09135 BZT14_03720 CA122_13445 CA124_14440 CAD25_13880 CAD70_18135 CAI12_16660 CB062_10255 CB096_14700 CB217_12805 CB220_14435 CB308_15940 CB345_18040 CB472_13065 CB501_11525 CB588_08220 CB596_12655 CB604_10145 CB666_16595 CB721_20345 CBB04_19195 CBB05_13840 CBK53_19215 CBN66_14655 CBN70_12475 CBP97_18655 CBQ45_13910 CBR92_19970 CBR95_11870 CBS03_20305 CBS08_20655 CBS18_16760 CBS39_20735 CBS55_14975 CBS77_09830 CBS78_13115 CBU16_17980 CC149_15825 CC297_18255 CC421_17090 CC678_12725 CC680_11650 CC754_11940 CC805_16855 CC853_16680 CCG98_12880 CCP20_16675 CD530_14030 CDG21_09565 CEA09_11005 CEI41_16725 CEM11_08675 CER90_13970 CEW05_18215 CFB87_11490 CFC01_18200 CFD56_12055 CRE05_02200 D0175_08570 D0A07_14920 D0W94_21365 D3E03_19475 D4415_18015 D4E56_15415 D4F08_19940 D4X57_18540 D4Z56_20190 D5A37_07260 D5O28_18970 D5O87_18615 D5X06_18105 D6J64_14370 D6K13_17205 D6P81_17650 D6R78_16230 D6S88_17785 D6T13_10065 D8Q93_17795 D8S08_07470 D9O81_17800 DLM07_05510 DLQ89_09585 DM648_22170 DMI96_14640 DN254_16985 DO678_17965 DOB11_13010 DOJ41_18470 DOR31_16660 DP790_14935 DP797_19060 DPF44_17095 DPR73_10030 DQ906_16405 DQY42_21185 DQZ81_15615 DRD18_11105 DRK03_17440 DRM04_20170 DRV81_18170 DRX23_19640 DRX96_13475 DS187_17705 DSH04_16815 DSH32_11170 DSN07_15575 DTD96_08125 DTF75_15870 DTI59_10095 DU772_16825 DU867_16745 DUA99_06710 DUB03_17090 DUG35_21095 DUG37_09455 DW487_05640 DY875_08435 DYT79_05520 E2D06_09125 E3C38_19875 E3C57_04960 E5382_12770 E5B97_15680 EAH10_10215 EBB65_17355 EBB99_17160 EBC54_19500 EBC72_13645 EES12_17090 EGL58_19555 EGM21_17370 EHF05_18050 EI456_17675 EI507_18340 EIL24_18235 EIL34_19605 EJG81_18690 EKH43_18120 EKP78_17715 EL812_18020 ELS48_18010 ELY67_16875 ENE83_16990 ERF73_18615 ETB65_18865 EU248_15750 EUZ49_23140 EVI13_02840 EVU69_19825 EZV86_08115 EZX35_16585 F9O36_14895 F9O65_17665 F9P74_18100 F9Q56_17905 FEE84_12285 FEO32_14500 FI281_14470 FI295_17155 FI296_17695 FII38_15555 FII69_17055 FPF90_15410 FTS15_19435 G0A20_15610 G0D20_21205 G0F92_04370 G0F99_20490 G0G00_15020 G0G01_14620 G0G02_01265 G0G04_14275 G0G05_11320 G0G06_08950 G0G07_03945 G0G14_13450 G0G15_05635 G0G16_18195 G0G17_18550 G0G20_12380 G0G22_03800 G0G23_02895 G0G27_20255 G0G31_04885 G0G32_18695 G0G35_22650 G0G37_21300 G0G38_05325 G0G39_05210 G0G40_00495 G0G41_05320 G0G43_20245 G0G45_03755 G0G49_12345 G0G50_02375 G0G51_12780 G0G52_02055 G0G53_14405 G0G54_12570 G0G55_02745 G0G60_04900 G0G61_21540 G0G62_03530 G0G64_11380 G2169_20120 G2170_17950 G2196_15620 G2210_18475 G2222_16940 G2233_16805 G2235_12530 G2237_14760 G2242_16685 G2243_18305 G2249_18265 G2264_16425 G2266_19975 G2271_14330 G2282_17940 G2286_15060 G2298_18170 G2300_17895 G2301_16625 G2322_17655 G2326_05510 G2331_17485 G2345_14690 G2351_11360 G2395_18425 G2410_17370 G2484_18475 G2668_16905 G2672_18505 G2673_12285 G2674_18195 G2681_14230 G2684_17165 G2685_16660 G2686_18420 G2687_17170 G2689_19715 G2693_13850 G2696_16030 G2699_17735 G2700_17140 G2703_18695 G2705_18350 G2706_16440 G2710_15110 G2716_19115 G2717_19090 G2719_18745 G2723_19745 G2726_18435 G2729_18855 G2730_16180 G2732_14990 G2737_11175 G2740_14430 G2745_14690 G2747_17475 G2749_19595 G2751_17145 G2757_17470 G2767_17765 G2784_16450 G2846_16730 G2849_14480 G2856_16940 G2858_16510 G2859_16270 G2860_18520 G2861_14560 G2862_16635 G2863_16285 G2866_13475 G2872_17555 G2874_18875 G2879_17610 G2880_17495 G2882_11825 G2888_18110 G2889_15285 G2890_17755 G2894_09340 G2896_13570 G2902_20700 G2905_11225 G2914_18010 G2939_05565 G2944_09900 G2954_06260 G2964_16835 G2968_15020 G2971_07585 G2973_04400 G2981_03795 G2984_05660 G2989_12910 G2991_03275 G3259_002224 G3346_003537 G3347_001862 G3348_002116 G3414_001902 G3453_002421 G3972_003350 G3984_004132 G3A07_07855 G3A13_18970 G3A29_16685 G3V00_002516 G3V03_003780 G3W49_001000 G4179_002628 G4B49_002728 G4B62_003839 G4D14_001210 G4G55_002523 G4G70_002745 G4J13_004244 G4J27_003406 G4K89_000861 G4L00_003905 G4L11_003511 G4O33_003194 G4O34_001052 G4O38_002777 G4O43_002653 G4P59_003264 G4P65_002509 G4P71_002341 G4Q33_002605 G4Q34_002222 G4Y16_001057 G4Y74_001950 G4Y75_002585 G9273_003139 G9374_002432 G9375_003558 G9C39_002301 G9G26_004226 G9G29_003563 G9G49_002046 G9W24_002411 G9W26_002811 G9W60_001328 GB008_18185 GB023_19730 GB033_06215 GB073_21190 GB084_15780 GB104_17820 GB108_20855 GB117_12760 GB119_19790 GB125_16930 GB136_14545 GB146_16180 GB163_19015 GB165_16740 GB167_14000 GB172_16190 GB174_14415 GB183_21130 GB184_15005 GB191_20690 GB220_18210 GB222_15290 GB260_14850 GB264_18960 GB267_21450 GB268_17125 GB322_04260 GB328_03375 GB340_20380 GB350_18005 GB366_20965 GB382_13880 GB384_17705 GB389_17130 GB395_14155 GB398_19660 GB400_17165 GB410_19810 GB411_20290 GB424_18050 GB444_15320 GB453_02390 GB458_14190 GB471_14430 GB474_15350 GB512_06355 GB517_16250 GB521_21110 GB522_13565 GB528_15755 GB536_16845 GB545_21125 GB552_05380 GB596_11600 GB605_13600 GB608_14220 GB611_21255 GB617_20665 GB638_12945 GBR90_15875 GBR92_06005 GBR96_18020 GBS02_10665 GBS31_18015 GBS51_18015 GBV48_20440 GBV49_21290 GBV51_16940 GBV59_05205 GBW10_15355 GBW37_21300 GBW40_14450 GBW61_14955 GBW81_14525 GBW91_19925 GBW93_16210 GBW94_20475 GBX02_18175 GBX28_03500 GBX30_16305 GBX44_07655 GBX50_18975 GBX65_09510 GBX79_02640 GBY10_21110 GBY16_20595 GBY22_15800 GBY30_14000 GBY40_12305 GBY43_19015 GBY51_02640 GBY55_13045 GBY69_02100 GBY71_13275 GBY80_15315 GBY98_15310 GBZ02_20775 GBZ07_05340 GBZ09_19665 GBZ19_06355 GBZ20_16245 GBZ21_20920 GBZ57_15255 GBZ88_16205 GBZ96_10620 GCS50_17180 GCY20_17660 GDA07_18585 GDH40_18035 GDI37_18915 GDI50_10605 GDN42_04680 GI500_18260 GI569_18355 GI571_19455 GI574_15255 GI576_17370 GI587_15930 GI598_19450 GI602_19455 GI603_18270 GI605_16665 GI606_17755 GI607_18225 GI610_19850 GI613_18970 GI616_19915 GI617_18250 GI618_19650 GI619_18185 GI623_19925 GI627_19930 GI628_20335 GI635_19450 GI641_19620 GI643_19215 GI648_16180 GI652_19115 GI653_18965 GI656_10830 GI657_16195 GI658_10970 GI661_14545 GI664_14465 GI666_14865 GI667_19440 GI672_16195 GI673_19155 GI678_16820 GI679_18005 GI681_20130 GI682_19670 GI684_16950 GJE23_19345 GJE52_20320 GJE53_18800 GJE57_19140 GJE58_18480 GJE61_19460 GJE63_19120 GJE66_17975 GJE68_19380 GJE69_16935 GJE75_19455 GJE76_19455 GJE78_19465 GJE80_18250 GJE81_19525 GJE83_18265 GJE85_18895 GJE87_17205 GJE88_18245 GJE91_18740 GJE97_17405 GJE99_16230 GJF01_19455 GJF04_19450 GJF05_19445 GJF06_19145 GJF07_16855 GJF11_14795 GJF12_19000 GJF15_18775 GJF17_18765 GJF18_19035 GJF25_18900 GJF26_19420 GJF28_19175 GJF31_18790 GJF33_18960 GJF41_19610 GJF44_19235 GJF47_19445 GJF49_19145 GJF51_20105 GJF54_19450 GJF59_18550 GJF61_19930 GJF63_18475 GJF64_19455 GJF68_18410 GJF69_18870 GJF75_19785 GJF76_19450 GJF77_19140 GJF78_19925 GJF81_16490 GJF83_18960 GJF85_19920 GJF86_18955 GJF88_19445 GJF90_20340 GJF91_20505 GJF93_19465 GJF95_18650 GJF99_17980 GJG01_19920 GJG02_19360 GJG03_14565 GJG05_14715 GJG07_11790 GJG10_16200 GJG11_15865 GJG13_13795 GJG14_16105 GJG15_14705 GJG16_17040 GJG17_14795 GJG18_23365 GJG24_15060 GJG25_15325 GJG26_16315 GJG28_16415 GJG29_14235 GJG30_16180 GJG35_16225 GJG37_15715 GJG38_18655 GJG39_18260 GJG40_14820 GJG45_19440 GJG48_17440 GJG49_18945 GJG51_19455 GJG54_21345 GJG57_19125 GJG58_19175 GJG60_18005 GJG63_17960 GJG66_18105 GJG70_17990 GJG71_16195 GJG76_18470 GJG77_18995 GJG81_16360 GJG84_18715 GNA67_003852 GNA68_003740 GNA89_003109 GNA90_003610 GNA94_003248 GNA95_003605 GNB01_003578 GNB24_003575 GNB30_003635 GNB32_003570 GNB39_003909 GNB51_003077 GNB52_003552 GNB53_003749 GNB87_003935 GNB90_003879 GYI57_002966 GYK12_04750 GYK13_17425 OB33_18235 R841_07660 ZQ07_09565 ZR89_19430 ZW25_11665] Bifunctional NAD(P)H-hydrate repair enzyme (Nicotinamide nucleotide repair protein) [Includes: ADP-dependent (S)-NAD(P)H-hydrate dehydratase (EC 4.2.1.136) (ADP-dependent NAD(P)HX dehydratase); NAD(P)H-hydrate epimerase (EC 5.1.99.6)]
[PTPN23 KIAA1471] Tyrosine-protein phosphatase non-receptor type 23 (EC 3.1.3.48) (His domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14)
[b3052 gmhC hldE hldE_1 rfaE A6592_00435 A6V01_11230 A8C65_08620 A9P13_03670 A9R57_07965 A9X72_03605 AC789_1c34150 ACN002_3137 ACN68_04475 ACN81_21385 ACU57_23480 ACU90_12285 AM270_10800 AM446_05045 AM464_07540 APT94_26205 APU18_17065 AUQ13_02370 AUS26_10705 AW059_22945 AWB10_03865 B7C53_03350 B9T59_16990 BANRA_01667 BANRA_03947 BANRA_04061 BB545_10535 BE963_06075 BEN53_18965 BHF03_08010 BHS81_18445 BHS87_17235 BIQ87_17315 BIU72_12905 BIZ41_23270 BJJ90_03475 BK248_17500 BK292_10940 BK296_12330 BK373_10845 BK375_11905 BK383_02355 BMA87_00545 BMT91_14515 BN17_29871 BOH76_02100 BON63_14995 BON65_07115 BON66_17425 BON69_18195 BON72_17905 BON75_07730 BON76_06300 BON83_08445 BON86_00820 BON87_14440 BON92_11755 BON94_07030 BON95_22825 BON96_07095 BON98_15280 BTQ06_15530 BUE81_13105 BvCms12BK_00795 BvCms2454_02331 BvCms28BK_00381 BvCmsC61A_01369 BvCmsHHP001_03639 BvCmsHHP019_01711 BvCmsKKP036_00378 BvCmsKKP061_04109 BvCmsKSNP073_03515 BvCmsKSNP081_00998 BvCmsKSNP120_03666 BvCmsKSP011_03976 BvCmsKSP024_04114 BvCmsKSP026_00366 BvCmsKSP045_01511 BvCmsKSP058_01975 BvCmsKSP067_02740 BvCmsNSP006_01620 BvCmsNSP007_02116 BvCmsNSP047_00207 BvCmsNSP072_04206 BvCmsOUP014_03877 BvCmsSINP011_01702 BvCmsSINP022_04780 BvCmsSIP019_03924 BvCmsSIP024_03225 BvCmsSIP044_00552 BVL39_10905 BWI89_23080 BXT93_07190 BZL31_14470 BZL69_23340 C4M78_02580 C5715_01850 C5F72_04045 C5F73_04245 C5N07_15975 C5P01_03380 C5P44_01180 C7235_03995 C7B02_08445 C7B06_14240 C7B07_11350 C7B08_02760 C9114_14300 C9160_03060 C9201_13325 C9306_08460 C9342_11460 C9E25_15185 C9Z03_08835 C9Z23_02895 C9Z28_01105 C9Z37_06640 C9Z70_07450 C9Z78_03980 CDC27_16340 CDL37_11480 CG692_21075 CI641_008535 CI693_02925 CI694_21580 CJU64_18250 CO706_13870 COD30_06455 COD46_13830 CQP61_04570 CR538_03840 CR539_20305 CRD98_10980 CRM83_24255 CV83915_03111 CWS33_20110 D0X26_08365 D2184_09755 D2185_01175 D3821_09655 D3822_05240 D3O91_09900 D3Y67_11715 D4023_02240 D4U49_07480 D4V08_00630 D5H35_04345 D6004_03255 D7Y10_10795 D7Z75_02220 D9610_02155 D9C99_04415 D9D20_05580 D9D31_10655 D9D43_19320 D9D44_03715 D9E34_06640 D9E35_01150 D9E49_21700 D9E73_14965 D9F32_00575 D9F87_05155 D9G42_07280 D9G48_20445 D9G69_00405 D9G95_08225 D9H53_00505 D9H68_14775 D9H70_04045 D9H94_02300 D9I18_14770 D9I87_12480 D9I88_01480 D9J03_01885 D9J11_00415 D9J44_07130 D9J52_07230 D9K02_05415 D9K48_19520 D9K54_26020 D9L99_10555 D9Z28_11860 DAH18_13185 DAH30_21210 DAH34_15480 DAH37_03420 DD762_05785 DEN89_08630 DEO04_12685 DEO20_06880 DIV22_09915 DJ503_22225 DL530_00435 DL545_04400 DL705_00525 DLU82_15070 DLX40_00535 DM102_14430 DM129_03270 DMZ30_02990 DN627_00600 DN660_00555 DN808_06395 DNC98_08435 DND79_00555 DNI21_09595 DNR35_11935 DNX30_09775 DOT59_00770 DOY61_13695 DOY67_00510 DP258_07225 DP277_05585 DQF57_02840 DQO13_00520 DQP61_13365 DRW19_00520 DS732_22855 DT034_00525 DTL43_13480 DTL90_11845 DTM10_07700 DTZ20_17050 DWB25_03955 DXT69_14985 DXT71_22640 DXT73_08600 E0I42_16350 E2112_15765 E2114_12140 E2115_13475 E2119_19800 E2127_16855 E2128_15000 E2129_17870 E2134_13310 E2135_17825 E4K53_05990 E4K55_05990 E4K60_02150 E4K61_08585 E5P24_07490 E5P28_13790 E5S34_14925 E5S38_15425 E5S42_11295 E5S44_12635 E5S58_02265 E5S62_00025 EA184_13370 EA213_01780 EA214_09350 EA219_08085 EA433_05380 EAI52_09405 EAM59_00295 EAX79_10120 EB525_RS06070 EBM08_04335 EC1094V2_602 EC3234A_51c01050 EC95NR1_02428 ECTO6_00705 ED600_02440 ED648_05065 EEP23_06735 EF082_03295 EG599_05105 EG808_03450 EHD79_08435 EHH55_23635 EHJ36_00275 EI021_21265 EI041_02695 EIA21_02180 EIZ93_03445 EJC75_14505 EKI52_18965 EL75_0634 EL79_0656 EL80_0649 ELT31_13705 ELT49_09375 ELT58_01120 ELU85_07620 ELV08_02295 ELV15_09140 ELV28_10035 ELX69_05765 ELX76_17125 ELX96_08995 ELY05_13320 ELY32_06075 ELY41_16305 ELY48_00505 EO241_13025 EPS91_01130 EPT01_01110 EQ823_04370 EQ825_06705 ERS085362_00748 ERS085374_02440 ERS085379_03763 ERS085386_00624 ERS085406_03234 ERS150873_01664 EST51_03425 ETECE1441_00696 ETECE1649_00729 ETECE1779_01234 ETECE36_01318 ETECE925_00736 EVY14_08085 ExPECSC038_02566 EXX06_14015 EXX13_07800 EXX23_10695 EXX24_05640 EXX53_05805 EXX55_13080 EXX71_10825 EXX87_03890 EYD11_03295 EYV18_05895 EYX82_22585 EYY34_08110 EYY78_13960 F0L67_15055 F1E19_13520 F6T45_14235 F6T51_14770 F6V70_10890 F7F23_04725 F7F26_01125 F7F56_24550 F7O57_21890 FKO60_05555 FNJ69_14185 FQ021_06490 FQ915_08205 FRV13_21255 FTV90_24955 FTV92_21940 FV293_12490 FV295_12700 FV438_09390 FVA71_03915 FZN30_14575 G5616_10180 G5668_00280 G5670_03970 G5680_04280 G5688_15125 G5696_02535 G6Z99_03290 G9448_18305 G9P49_03265 G9P50_03205 GE057_04375 GE096_13920 GE558_14065 GFY48_06160 GHD50_05520 GJ11_20025 GKF34_14080 GKF39_22130 GKF52_13855 GKF74_19765 GKF86_21680 GKF89_10355 GKG12_09255 GNZ05_17865 GP650_03495 GP662_09090 GP666_20655 GP698_03395 GP720_14320 GP935_12630 GP945_06995 GP946_07950 GP979_05015 GQE22_03925 GQE33_06255 GQE34_14895 GQE36_05815 GQE42_09790 GQE64_17735 GQF59_09930 GQM04_04720 GQM09_03340 GQM10_12650 GQM13_08735 GQM17_09870 GQM18_08210 GQM28_03685 GQN24_18505 GRW02_02445 GRW30_16405 GRW57_20255 GRW80_00400 GRW81_06010 GUB08_01065 GUB85_14200 GUB91_09125 GUB95_09235 GUC01_10780 GUC12_09995 GXC14_12960 H4P50_03265 H4P51_03255 H5C68_02690 H5C80_07125 HCR07_21325 HF523_18350 HFD31_002808 HFD39_001668 HFD59_000729 HFD69_000474 HFU80_003431 HGR17_04950 HGT58_16380 HH456_001008 HH707_002962 HH830_001471 HHH24_003294 HHH97_000121 HHJ41_11765 HI083_000845 HIB31_000115 HIO03_001885 HIO61_002488 HIQ74_001416 HIQ82_000418 HIR91_001781 HIT56_000577 HIT59_000310 HIZ62_004026 HJ359_000434 HJ802_001838 HJM89_000990 HJQ03_000712 HJR60_000693 HJR92_000500 HJU54_000209 HJV81_002902 HK427_002782 HKA14_001418 HKA57_004747 HKC58_004628 HL152_00885 HLQ75_02070 HLQ92_03455 HLT96_19475 HLU98_14790 HmCms184_00990 HmCmsJML074_03664 HmCmsJML079_03547 HmCmsJML204_02830 HMG20_12430 HMG24_16410 HMG27_14830 HMG35_15055 HMP86_06435 HMQ05_14960 HMT01_08140 HMT08_03460 HMW26_00600 HNC38_04490 HNC40_13430 HNC59_18495 HNC73_02640 HNC75_05185 HNC80_18285 HNC88_16615 HNC94_13345 HNC99_14510 HND23_18660 HNN86_15470 HNO03_02065 HNV44_00315 HP431_17160 HPE39_22100 HPE49_10350 HPM96_19120 HS093_17245 HV005_03310 HV021_03290 HV022_03230 HV068_03410 HV108_03725 HV109_03430 HV152_03365 HV156_17060 HV159_19710 HV168_18640 HV188_21140 HV226_08990 HV244_03305 HV297_03260 HVV38_19980 HVV39_07820 HVV53_12525 HVV70_18470 HVV73_03580 HVV78_19945 HVV92_03835 HVW09_20905 HVW11_13960 HVW37_03380 HVW43_20120 HVW44_00950 HVW45_03420 HVW59_17750 HVW60_03340 HVW76_03380 HVW90_17650 HVW93_19175 HVW98_19555 HVX17_03675 HVX22_03470 HVX24_03405 HVX33_17540 HVX51_03825 HVX96_18060 HVY01_03285 HVY79_19885 HVY93_03295 HVZ24_03285 HVZ44_03260 HVZ53_03410 HVZ62_18250 HVZ71_03840 HW43_20185 HX136_02965 HXS78_03280 MJ49_15010 NCTC10082_03101 NCTC10089_00754 NCTC10764_04134 NCTC10865_00971 NCTC10963_00720 NCTC11112_00689 NCTC11181_02981 NCTC11341_01577 NCTC12950_00740 NCTC13148_03076 NCTC13216_01096 NCTC13846_00753 NCTC8179_06244 NCTC8622_07744 NCTC8959_03025 NCTC8960_03387 NCTC9007_04276 NCTC9036_00803 NCTC9045_00858 NCTC9050_03858 NCTC9055_02635 NCTC9058_01128 NCTC9062_02434 NCTC9073_05371 NCTC9077_00928 NCTC9111_01145 NCTC9119_00773 NCTC9703_05253 NCTC9706_02997 PGD_04060 PU06_24125 RG28_20105 RK56_015360 RX35_04139 SAMEA3472043_01645 SAMEA3472044_01817 SAMEA3472047_02392 SAMEA3472055_00520 SAMEA3472056_04213 SAMEA3472070_01292 SAMEA3472080_00829 SAMEA3472090_00438 SAMEA3472108_00220 SAMEA3472110_03099 SAMEA3472112_02815 SAMEA3472114_00641 SAMEA3472147_03836 SAMEA3484427_00726 SAMEA3484429_00616 SAMEA3484434_04257 SAMEA3485101_01591 SAMEA3752372_03180 SAMEA3752553_01320 SAMEA3752557_02675 SAMEA3752559_03783 SAMEA3752620_02230 SAMEA3753064_03862 SAMEA3753097_01768 SAMEA3753164_02190 SAMEA3753290_04101 SAMEA3753300_03363 SK85_03365 TUM18780_06640 UC41_12980 UN86_16100 UN91_14925 WP2S18E08_07310 WP4S17E08_06560 WP4S18E07_06710 WP4S18E08_06660 WP7S17E01_07440 WP7S17E04_06510 WP7S18E09_06520 WQ89_07365 WR15_04710 YDC107_1731] Bifunctional protein HldE [Includes: D-beta-D-heptose 7-phosphate kinase (EC 2.7.1.167) (D-beta-D-heptose 7-phosphotransferase) (D-glycero-beta-D-manno-heptose-7-phosphate kinase); D-beta-D-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) (D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase)]
[hchA AM465_15370 AWF59_019055 AZZ83_004235 B9N33_26475 BFD68_20845 BvCmsSIP024_00478 C7B02_06890 C9Z28_17130 CCZ14_26645 CCZ17_22700 CRT43_11430 CUB99_23505 D3C88_02905 D9D33_15385 D9D94_15735 D9E49_19020 D9I20_10460 D9J46_03345 D9J61_14085 DL979_00380 DMZ50_24495 DNR41_00375 DS966_16070 DU333_03260 DW236_02290 E0L04_20335 EA167_21075 EA191_21560 EA203_21510 EA219_19670 EA233_11705 EA239_03275 EA435_21775 EA834_21700 ECTO124_02024 EGT48_04930 ELT22_00120 ELT23_21030 ELT31_15055 ELT33_08025 ELU82_24705 ELU96_05025 ELV00_23040 ELV13_26065 ELV22_24670 ELX56_18060 ELX68_24130 ELX70_18575 ELX79_15035 ELX83_25640 ELY23_20490 ELY24_19085 ELY50_24510 EPS70_02360 EPS76_06485 EPS91_17475 EPS94_00505 ERS085406_02591 EWK56_00075 ExPECSC065_02714 FNJ67_10775 FPI65_11895 FV295_16190 G3565_20565 GE087_19940 GE400_20550 GFU47_04835 GKF34_00055 GKF52_21815 GP711_13090 GRC73_11620 HGR87_26580 HGR88_24645 HGS97_24525 HH117_21485 HH814_003508 HHA77_004902 HHG54_002777 HHJ44_00410 HIR91_000046 HJL93_000069 HJO44_003082 HJS53_002364 HJT66_002642 HL186_22535 HLI97_002776 HNX16_14525 HNX34_17210 HR075_03435 HV055_10025 HV108_15170 HV131_16195 HV297_08920 HV303_03770 HVV39_22385 NCTC7928_05955 NCTC8450_02317 NCTC9007_02951 NCTC9075_02834 SY51_11150 U14A_02105 WP4S17E03_18550 WP7S17E01_20170] Protein/nucleic acid deglycase HchA (EC 3.1.2.-) (EC 3.5.1.124) (Maillard deglycase)
[serS serS_1 serS_2 serS_4 serS_5 serS_6 A6581_00810 A6592_05340 A6V01_07325 A8C65_20940 A9819_04700 A9P13_17260 A9R57_09085 A9X72_16505 AC067_07780 ACN002_0943 ACN68_18445 ACN81_15280 ACU57_24880 ACU90_17985 AJ318_10610 AM270_11850 AM446_18810 AM464_22440 AM465_22075 AMK83_05145 AML35_13145 APT94_21865 APU18_21610 ARC77_24445 AU473_21725 AUQ13_14630 AUS26_03670 AW059_02120 AWB10_16795 AWE53_021390 AWF59_024965 AWG78_003575 AWP75_21915 AZZ83_000627 B6V57_04540 B7C53_06260 B9N33_02000 B9T59_23270 BANRA_01408 BANRA_01489 BANRA_01497 BANRA_04806 BB545_19235 BE963_18795 BEN53_13685 BER14_07045 BFD68_05800 BHF03_20585 BHS81_05405 BHS87_04765 BIQ87_04930 BIU72_07920 BIZ41_01135 BJJ90_17070 BK248_03715 BK292_16790 BK296_19820 BK334_18275 BK373_22405 BK383_04195 BMT49_06620 BMT91_16330 BN17_07131 BOH76_14710 BON63_22100 BON65_05225 BON66_20490 BON69_00875 BON72_18695 BON75_14805 BON76_25880 BON83_05990 BON86_07915 BON87_16310 BON91_16300 BON92_21805 BON94_25310 BON95_16890 BON96_26620 BON98_20150 BTQ06_12090 BUE81_16200 BvCms12BK_01342 BvCms2454_00991 BvCms35BK_04838 BvCmsC61A_02598 BvCmsHHP001_03534 BvCmsHHP019_05412 BvCmsHHP056_01337 BvCmsKKP036_03453 BvCmsKKP061_03719 BvCmsKSNP073_02323 BvCmsKSNP081_03935 BvCmsKSNP120_02546 BvCmsKSP011_02157 BvCmsKSP024_00103 BvCmsKSP026_03375 BvCmsKSP045_00089 BvCmsKSP067_00004 BvCmsKSP076_05000 BvCmsNSP006_03200 BvCmsNSP047_01055 BvCmsNSP072_00842 BvCmsOUP014_00112 BvCmsSINP011_03851 BvCmsSINP022_01229 BvCmsSIP019_02726 BvCmsSIP024_03345 BvCmsSIP044_04081 BVL39_23805 BW690_07840 BWI89_09585 BWP17_23890 BXT93_21635 BZL31_18935 BZL69_06600 C2M16_01030 C2U48_05300 C4K41_13965 C4M78_08480 C5715_04275 C5F72_17130 C5F73_12345 C5N07_03160 C5P01_20195 C5P44_03450 C6669_24940 C6B13_07620 C7235_16030 C7B02_02150 C7B06_01115 C7B07_01020 C7B08_06925 C7B18_04370 C9114_12255 C9160_08690 C9201_07620 C9306_09955 C9342_04535 C9E25_05255 C9E67_20775 C9Z03_16085 C9Z28_17930 C9Z37_09065 C9Z43_09695 C9Z68_12445 C9Z70_17345 C9Z78_21685 CA593_24095 CCZ14_21745 CCZ17_01545 CDC27_03875 CDL37_17565 CG692_03260 CI641_020260 CI693_12230 CI694_06665 CJU64_05085 CO706_27300 COD30_19105 COD46_03775 CQB02_11420 CQP61_10440 CR538_16685 CR539_09035 CRD98_05275 CRE06_10240 CRM83_10850 CRT43_04770 CSB64_07825 CT146_05295 CUB99_03995 CVH05_14755 CWM24_28765 CWS33_13225 D0X26_04645 D2184_05830 D2185_10095 D2188_11285 D3821_00085 D3822_26895 D3C88_30315 D3O91_13920 D3Y67_19230 D4011_13350 D4023_15090 D4074_13655 D4660_14975 D4L91_11285 D4M06_03350 D4M76_04855 D4U49_00500 D4U85_15420 D4V08_03200 D5H35_14995 D5I97_11785 D6004_13360 D6C36_03255 D6D43_07045 D6T60_13330 D6X63_06060 D6X76_07735 D7K33_04855 D7K63_14945 D7K66_13685 D7Y10_02090 D7Z75_12545 D8Y65_14265 D9610_14290 D9C99_06800 D9D20_09210 D9D31_19840 D9D33_10255 D9D43_08225 D9D44_13750 D9D94_01030 D9E34_23120 D9E35_13435 D9E49_16625 D9E73_09920 D9F32_11265 D9F87_06920 D9G11_15100 D9G42_01060 D9G48_26250 D9G69_07415 D9G95_03785 D9H36_08335 D9H53_18965 D9H68_02135 D9H70_17325 D9I18_00615 D9I20_13980 D9I37_09100 D9I87_16815 D9I97_00620 D9J03_07550 D9J11_05105 D9J44_09925 D9J46_22080 D9J52_10425 D9J60_01860 D9J61_15890 D9K02_15875 D9K48_01420 D9K54_01180 D9L89_15485 D9L99_01165 D9X77_12410 D9X97_14195 D9Z28_17205 DAH23_13105 DAH30_00610 DAH34_01020 DAH37_00480 DB359_01590 DD762_22360 DEN86_14200 DEN89_03320 DEO04_09990 DEO20_10265 DIV22_10730 DJ503_04545 DL455_13790 DL530_12865 DL545_16310 DL705_03395 DL800_06835 DL979_17455 DLT82_07370 DLU82_13445 DLW88_03560 DLX40_12450 DM102_05410 DM129_00100 DM155_12630 DM962_11620 DMI04_12345 DMI53_02995 DMO02_15950 DMZ30_09795 DN627_15065 DN660_14685 DN703_14070 DN808_10540 DNB37_02940 DNC98_22420 DND16_15655 DND79_08950 DNI21_08535 DNJ62_03245 DNK12_13300 DNR41_03995 DNX30_24450 DOE35_25050 DOS18_12375 DOT59_14030 DOT81_14030 DOU81_13360 DOY22_06430 DOY56_12815 DOY61_08495 DOY67_15740 DP258_11225 DP277_02995 DQF57_04800 DQG35_14715 DQO13_11405 DQP61_10675 DRP48_05160 DRW19_13920 DS143_16420 DS721_01670 DS732_09465 DS966_03385 DT034_02055 DTL43_10280 DTL90_05665 DTM10_14800 DTM45_05290 DTZ20_02315 DU321_00200 DU333_10845 DW236_14905 DWB25_09210 DXT69_25485 DXT71_04895 DXT73_10575 DXX80_021485 E0I42_08675 E0L04_13945 E0L12_07010 E2112_02215 E2114_04170 E2115_01790 E2119_08405 E2127_01030 E2128_09230 E2129_04715 E2134_05400 E2135_02160 E2148_04720 E2855_00955 E2863_00975 E4K53_00685 E4K55_00685 E4K61_04530 E5P24_13475 E5P28_20045 E5S34_05555 E5S38_08935 E5S42_14230 E5S44_15170 E5S56_06450 E5S58_20005 E5S61_08445 E5S62_04765 EA167_04610 EA174_01235 EA184_00355 EA191_01765 EA203_03390 EA211_13025 EA213_05875 EA214_06620 EA218_04625 EA219_18175 EA225_03895 EA233_17775 EA239_01360 EA250_01340 EA433_07180 EA435_03495 EA834_04280 EAI42_01470 EAI52_21980 EAM59_11470 EAN77_13945 EAX79_17605 EB509_02995 EB510_00405 EB515_14985 EB525_RS01030 EBJ06_09410 EBM08_10095 EBP16_06375 EC1094V2_2940 EC3234A_14c00890 EC382_03750 EC95NR1_05169 ECONIH1_05715 ECs0978 ECTO124_03292 ECTO124_03324 ECTO6_03106 ED225_06285 ED600_15420 ED607_03235 ED611_07595 ED903_00875 ED944_10525 EEA45_01540 EEP23_19940 EF082_00985 EF173_11570 EG599_05640 EG808_08895 EGT48_23850 EGU87_11900 EH412_17335 EHD63_12735 EHD79_04400 EHH55_13110 EHJ36_17845 EHJ66_09220 EHV81_09065 EHV90_07710 EHW09_08700 EHX09_13305 EI021_00975 EI032_16605 EI041_07645 EIA08_01995 EIA21_05810 EIZ93_00680 EJC75_02960 EKI52_05980 EL75_2896 EL79_2768 EL80_2950 ELT17_07920 ELT22_07145 ELT23_02430 ELT31_02890 ELT33_00675 ELT48_03175 ELT49_21260 ELT58_02695 ELU82_00865 ELU85_00635 ELU96_02120 ELV00_01400 ELV08_06750 ELV13_16795 ELV15_12110 ELV22_02980 ELV24_01385 ELV28_02950 ELX56_08930 ELX61_02835 ELX68_03125 ELX69_04370 ELX70_05790 ELX76_21740 ELX79_22435 ELX83_03600 ELX96_05740 ELY05_10875 ELY23_01560 ELY24_24575 ELY32_11025 ELY41_13895 ELY48_24100 ELY50_20440 EO241_05330 EPS70_08530 EPS91_18425 EPS94_06005 EPT01_11740 EPU41_04755 EQ820_23590 EQ823_09305 EQ825_11795 EQ830_16025 ERL57_03490 ERS085362_01366 ERS085366_02541 ERS085374_01181 ERS085379_02440 ERS085383_00468 ERS085386_01955 ERS085404_00540 ERS085406_01274 ERS150873_00143 EST51_16120 ETECE1373_03061 ETECE1441_03051 ETECE1649_03001 ETECE1779_03707 ETECE36_04019 ETECE925_03080 EVY14_22630 EWK56_13500 EXM29_12665 ExPECSC038_03310 ExPECSC065_02785 EXX06_02235 EXX13_21305 EXX23_04160 EXX24_07625 EXX53_20060 EXX55_00210 EXX71_06525 EXX87_12110 EYD11_14975 EYV18_19585 EYX82_01845 EYY27_01785 EYY78_09855 F0L67_03845 F6T45_09805 F6T51_01360 F7F11_21825 F7F23_10010 F7F26_11230 F7F56_08185 F7G03_08695 F7O57_09030 F9B07_02155 F9X20_012965 F9X20_13065 FAF34_015220 FE846_07490 FKO60_07740 FNJ67_17855 FNJ69_01535 FORC82_3072 FPI65_05370 FQ021_11915 FQ915_05775 FQU83_17655 FRV13_06395 FV250_04865 FV293_02725 FV295_18645 FV438_04555 FVA71_17490 FVB16_11370 FWK02_01625 FZC17_18300 FZN26_11100 FZN30_20175 G3565_10700 G4280_16325 G5603_01520 G5608_01520 G5616_22355 G5632_05465 G5668_09510 G5670_09450 G5680_09925 G5688_00030 G5696_09560 G6Z99_16320 G9448_06070 G9P49_14420 G9P50_13650 GE057_06860 GE087_00055 GE096_12510 GE400_00080 GE558_18875 GFU47_06045 GFY48_01790 GHD50_11260 GIJ01_02530 GIY13_20875 GIY19_01855 GJ11_04950 GJD97_18910 GKE29_11075 GKE58_17505 GKE60_17775 GKE79_10340 GKE87_20775 GKF34_19735 GKF39_05675 GKF52_19000 GKF74_04395 GKF86_06390 GKG12_04680 GNX12_15090 GNZ02_05970 GNZ05_08705 GP650_11610 GP662_17780 GP698_08590 GP711_00460 GP720_08140 GP935_00685 GP945_18155 GP946_18040 GQE22_06025 GQE33_04525 GQE34_07795 GQE36_03230 GQE42_02520 GQE64_04860 GQE87_02545 GQF59_19410 GQM06_06865 GQM09_13540 GQM13_17405 GQM17_07610 GQM18_00815 GQM28_16245 GQN24_06905 GQY14_00190 GRC73_02835 GRW02_16590 GRW05_04940 GRW30_21495 GRW57_11630 GRW80_10905 GRW81_12390 GUB08_12465 GUB85_07075 GUB91_06515 GUB95_05485 GUC01_02610 GUC12_06515 GUI16_22200 GUI33_16300 GXC14_06520 H4P50_16895 H4P51_16745 H5C68_14075 H5C80_19785 HCR07_08785 HF065_000414 HF523_12135 HFD31_003147 HFD39_003387 HFD59_001694 HFD69_001304 HFU80_000403 HGR17_08885 HGR36_03420 HGR87_06615 HGR88_09645 HGS12_04415 HGS82_01895 HGS97_07645 HGT58_11530 HH117_22055 HH456_001752 HH707_004489 HH814_001469 HH830_004273 HHG54_000062 HHH24_001189 HHH97_004172 HHJ41_24650 HHJ44_05815 HHJ51_01895 HI055_001736 HI083_001322 HIA56_000375 HIB31_003365 HIN76_000406 HIO03_002303 HIQ74_000274 HIQ82_002451 HIR91_003709 HIT56_003705 HIT59_000120 HIZ44_001667 HIZ62_001493 HJ359_004128 HJ411_000091 HJ802_003916 HJI76_004703 HJI79_001125 HJL93_001339 HJM41_001068 HJM89_000904 HJN45_001689 HJO44_000473 HJQ03_001707 HJR58_001297 HJR60_000134 HJR92_001930 HJS12_001464 HJS53_001353 HJT66_000517 HJT90_000709 HJU54_001376 HJV81_002424 HK427_001420 HKA14_002162 HKA45_003276 HKA57_002020 HKC58_002486 HL152_06015 HL186_00055 HL465_04520 HL563_08735 HL601_13895 HLI97_004304 HLQ75_14840 HLQ92_18020 HLT96_00990 HLU13_03270 HLU98_15420 HLY53_13485 HLZ85_05555 HmCms169_02101 HmCmsJML074_04935 HmCmsJML079_04113 HmCmsJML146_02774 HmCmsJML204_03766 HMG20_06770 HMG24_16010 HMG27_07070 HMG35_08295 HMP86_03600 HMPREF3040_01024 HMQ05_22060 HMT01_15950 HMT08_23450 HMW26_24170 HNC38_22620 HNC40_16735 HNC59_17965 HNC73_09765 HNC75_09030 HNC80_09975 HNC88_03915 HNC94_04050 HNC99_19515 HND23_09975 HNN81_01200 HNN86_10510 HNO03_07435 HNO08_02630 HNV44_15950 HNV94_02265 HNX16_00055 HNX34_11420 HNY58_16450 HP431_04975 HPE39_08400 HPE49_23165 HPE52_13080 HPM96_13410 HR075_21395 HS093_06065 HV005_14125 HV021_14610 HV022_15545 HV055_15120 HV065_02570 HV068_15755 HV098_16305 HV108_08870 HV109_15595 HV131_21405 HV149_15810 HV152_15310 HV156_05085 HV159_07355 HV168_06435 HV188_08610 HV244_14165 HV303_22845 HV348_15690 HVV38_07025 HVV39_21450 HVV53_25045 HVV70_07580 HVV73_15275 HVV78_07875 HVV92_16460 HVW04_06515 HVW09_07595 HVW11_01875 HVW22_21295 HVW37_16380 HVW43_07860 HVW44_12180 HVW45_15505 HVW59_06140 HVW60_15030 HVW76_14280 HVW90_05250 HVW93_07735 HVW95_07935 HVW98_07465 HVX17_16210 HVX22_14720 HVX24_14450 HVX30_08235 HVX32_07495 HVX33_06275 HVX51_15800 HVX60_06455 HVX69_16090 HVX73_15145 HVX96_06660 HVY01_15160 HVY77_17270 HVY79_07940 HVY93_15275 HVZ20_08000 HVZ21_15260 HVZ24_14540 HVZ29_07800 HVZ42_15395 HVZ44_15325 HVZ47_07680 HVZ53_15960 HVZ62_06675 HVZ71_16185 HW43_08185 HWQ66_20010 HX136_16605 HXS78_14775 HZT35_08510 IB283_07600 IEM32_10085 MJ49_01660 MS6198_10350 MS8345_00900 NCTC10082_05157 NCTC10090_00468 NCTC10764_04686 NCTC10767_04731 NCTC10963_03749 NCTC11112_04619 NCTC11181_00470 NCTC12950_03592 NCTC13148_05960 NCTC13216_03492 NCTC13846_01848 NCTC7922_06950 NCTC7927_03649 NCTC7928_00790 NCTC8179_02402 NCTC8450_03726 NCTC8500_03602 NCTC8621_03421 NCTC8622_06274 NCTC8959_00501 NCTC8960_00573 NCTC8985_02032 NCTC9007_02128 NCTC9044_04188 NCTC9045_03786 NCTC9050_01187 NCTC9055_00054 NCTC9055_05140 NCTC9055_05154 NCTC9058_03691 NCTC9062_05090 NCTC9073_02278 NCTC9081_03167 NCTC9111_03370 NCTC9117_04086 NCTC9119_03416 NCTC9434_03366 NCTC9701_03495 NCTC9702_03782 NCTC9706_00616 NCTC9777_03310 NCTC9962_02162 NCTC9969_03408 PGD_02399 PU06_08930 RG28_19025 RK56_001100 RX35_02582 SAMEA3472043_03235 SAMEA3472047_00615 SAMEA3472055_02218 SAMEA3472056_00321 SAMEA3472070_02939 SAMEA3472080_00673 SAMEA3472090_02540 SAMEA3472108_04301 SAMEA3472110_02864 SAMEA3472112_03018 SAMEA3472114_01441 SAMEA3472147_02569 SAMEA3484427_02807 SAMEA3484429_00104 SAMEA3484434_00542 SAMEA3485101_05122 SAMEA3752372_03348 SAMEA3752553_02848 SAMEA3752557_03357 SAMEA3752559_02535 SAMEA3752620_02933 SAMEA3753064_00756 SAMEA3753164_02750 SAMEA3753290_02580 SAMEA3753300_01825 SK85_00962 SY51_04575 TUM18780_27300 U14A_00877 UN86_29050 WP2S18E08_30330 WP4S17E03_30650 WP4S17E08_30450 WP4S18E07_29350 WP4S18E08_28800 WP5S18E08_30770 WP5S18E09_29830 WP7S17E01_31570 WP7S17E04_28600 WP7S18E09_32280 WQ89_23795 WR15_12020 YDC107_4162] Serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (SerRS) (Seryl-tRNA(Ser/Sec) synthetase)
[ORF1ab orf1ab] 3C-like proteinase (EC 3.4.19.12) (EC 3.4.22.69) (Growth factor-like peptide) (Leader protein) (Non-structural protein 10) (Non-structural protein 2) (Non-structural protein 3) (Non-structural protein 4) (Non-structural protein 6) (Non-structural protein 7) (Non-structural protein 8) (Non-structural protein 9) (Papain-like proteinase) (p65 homolog)
[PTPRN2 KIAA0387] Receptor-type tyrosine-protein phosphatase N2 (R-PTP-N2) (EC 3.1.3.-) (EC 3.1.3.48) (Islet cell autoantigen-related protein) (IAR) (ICAAR) (Phogrin) [Cleaved into: IA-2beta60]
[trmG/rlmN rlmN trmG yfgB A6592_14810 A6V01_10375 A8C65_04030 A9819_14550 A9P13_06895 A9R57_16865 A9X72_06810 AC067_02950 AC789_1c28530 ACN002_2556 ACN81_26500 ACU57_06350 ACU90_01310 AJ318_07960 AM270_07035 AM446_08210 AM464_04385 AM465_11765 AMK83_11160 AML35_21610 APT94_12400 APU18_00360 AUQ13_13040 AUS26_08690 AW059_06025 AWB10_07085 AWE53_011275 AWG78_019550 AWP75_00070 AZZ83_002709 B6V57_13620 B7C53_07540 B9N33_21185 B9T59_21175 BANRA_01062 BANRA_03215 BANRA_04560 BE963_28360 BEN53_15775 BER14_02590 BFD68_15090 BHF03_05255 BHS81_15395 BHS87_14270 BIQ87_14620 BIU72_16370 BJJ90_06685 BK248_16765 BK292_08645 BK296_18950 BK334_04830 BK373_05980 BK375_00815 BK383_22780 BMA87_03835 BMT49_16115 BMT91_09905 BN17_18041 BOH76_09470 BON63_10575 BON65_15810 BON66_22820 BON69_13810 BON72_11205 BON75_17720 BON76_02575 BON83_11320 BON86_12640 BON87_06460 BON91_13805 BON94_05415 BON95_11790 BON96_15830 BON98_06620 BTQ06_16480 BUE81_08190 BvCms12BK_01738 BvCms2454_04503 BvCms28BK_03606 BvCmsC61A_04011 BvCmsHHP001_03026 BvCmsHHP019_02198 BvCmsHHP056_04619 BvCmsKKP036_01376 BvCmsKKP061_03901 BvCmsKSNP073_01414 BvCmsKSNP081_01848 BvCmsKSNP120_01490 BvCmsKSP011_00183 BvCmsKSP024_05098 BvCmsKSP026_04340 BvCmsKSP045_04902 BvCmsKSP058_00654 BvCmsKSP067_00335 BvCmsKSP076_03143 BvCmsNSP006_04134 BvCmsNSP007_00625 BvCmsNSP047_01354 BvCmsNSP072_00302 BvCmsOUP014_02913 BvCmsSINP011_00631 BvCmsSINP022_03339 BvCmsSIP019_03856 BvCmsSIP024_00144 BvCmsSIP044_05057 BVL39_14230 BW690_04435 BWI89_00645 BXT93_23315 BZL31_13730 BZL69_10350 C2M16_05985 C2U48_21500 C4K41_12625 C4M78_10825 C5715_18240 C5F72_07495 C5F73_20975 C5N07_10290 C5P01_05735 C5P44_15080 C6669_16135 C6B13_02185 C7235_06980 C7B02_18580 C7B06_11180 C7B07_12375 C7B08_05355 C9114_06285 C9160_05080 C9201_01175 C9306_06780 C9342_12845 C9E25_16270 C9Z03_13630 C9Z23_13135 C9Z28_02160 C9Z37_03330 C9Z43_04655 C9Z68_01925 C9Z70_01935 C9Z78_13405 CA593_14235 CCZ14_17665 CCZ17_16225 CDC27_13330 CDL37_24715 CG692_02760 CI641_005480 CI693_09030 CI694_19510 CJU64_14865 CO706_10475 COD30_00870 COD46_11325 CQP61_08055 CR538_07070 CR539_17585 CRD98_14935 CRM83_27670 CRT43_15050 CSB64_12435 CT146_18320 CUB99_20460 CV83915_03601 CWM24_13060 CWS33_10185 D0X26_11685 D2184_18550 D2185_06515 D3821_11620 D3822_03335 D3C88_06370 D3O91_03745 D3Y67_12440 D4023_12275 D4M76_05955 D4U49_06780 D4V08_04905 D5H35_00810 D6004_00805 D6T60_00380 D7Y10_10215 D7Z75_10425 D9610_05225 D9C99_13725 D9D20_07385 D9D31_00370 D9D33_16370 D9D43_09950 D9D44_02335 D9D94_08225 D9E34_00370 D9E35_16560 D9E73_01935 D9F32_08345 D9F87_13080 D9G11_06615 D9G42_20390 D9G48_14095 D9G69_08980 D9G95_02685 D9H36_02140 D9H53_23860 D9H68_00810 D9H70_10165 D9I18_09690 D9I20_05535 D9I87_02795 D9I97_08080 D9J03_03635 D9J11_04465 D9J44_00235 D9J46_23345 D9J52_02050 D9J61_05815 D9K02_02585 D9K48_26015 D9L99_09540 D9Z28_10675 DAH18_00395 DAH30_03130 DAH34_02445 DAH37_20190 DB359_21015 DD762_08480 DEN86_11890 DEN89_10165 DEO04_07620 DEO20_02970 DIV22_31970 DJ503_17770 DL530_01375 DL545_07420 DL705_14050 DL979_09885 DLU82_05920 DLW88_09815 DLX40_07590 DM102_07345 DM129_09205 DM155_03385 DMZ30_08130 DMZ50_09570 DN627_12030 DN660_09735 DN808_02330 DNC98_12775 DND79_08295 DNI21_06660 DNQ45_19770 DNR35_11100 DNR41_15845 DNX30_07300 DOT59_09565 DOY61_05500 DOY67_03525 DP258_07385 DP277_03795 DQF57_10795 DQO13_10725 DQP61_06500 DRW19_07220 DS143_00675 DS732_18710 DS966_02795 DT034_06550 DTL43_01735 DTL90_08410 DTM10_01190 DTZ20_20480 DU333_02535 DW236_17415 DWB25_07135 DXT69_12900 DXT71_14710 DXT73_14655 E0I42_02270 E0L04_08140 E2112_00685 E2114_06960 E2115_11285 E2119_09875 E2127_04065 E2128_10195 E2129_06365 E2134_09680 E2135_00755 E2148_02205 E4K53_08100 E4K55_08100 E4K60_01410 E4K61_08025 E5P24_03895 E5P28_04365 E5S34_13060 E5S38_12865 E5S42_09145 E5S44_13485 E5S56_14235 E5S58_10410 E5S62_08765 EA167_02510 EA184_11530 EA191_06650 EA203_05750 EA211_05615 EA213_03700 EA214_07830 EA218_15640 EA219_14840 EA239_20230 EA250_18905 EA433_03930 EA435_09775 EA834_17515 EAI42_02145 EAI46_01515 EAM59_02230 EAN77_05040 EAX79_07455 EB525_RS04055 EBM08_03715 EBP16_10220 EC1094V2_1153 EC3234A_44c01240 EC382_03160 ECONIH1_14700 ECTO124_01382 ECTO6_01317 ED600_07595 ED648_04450 EEP23_02525 EF082_05715 EG599_00810 EG808_01530 EGT48_08195 EH412_02175 EHD79_10000 EHH55_22035 EHJ36_02250 EI021_11910 EI032_05560 EI041_00375 EIA08_10580 EIA21_07300 EIZ93_07310 EJC75_11605 EKI52_22155 EL75_1132 EL79_1143 EL80_1146 ELT22_15160 ELT23_06240 ELT31_20735 ELT33_03485 ELT48_12685 ELT49_02150 ELT58_05380 ELU82_10165 ELU85_10200 ELU96_08545 ELV00_07005 ELV08_03465 ELV13_08960 ELV15_02340 ELV22_09560 ELV24_05605 ELV28_12120 ELX56_05045 ELX61_00815 ELX68_07260 ELX69_02835 ELX70_19965 ELX76_10880 ELX79_06535 ELX83_16235 ELX96_00240 ELY05_02305 ELY23_05915 ELY24_15685 ELY32_00370 ELY41_04640 ELY48_14670 ELY50_14360 EO241_18280 EPS76_15365 EPS91_03570 EPS94_13945 EPT01_14960 EPU41_14595 EQ820_10445 EQ823_08755 ERL57_11605 ERS085362_00075 ERS085366_00250 ERS085374_00074 ERS085379_00942 ERS085386_03207 ERS085406_03459 ERS150873_01429 EST51_07205 ETECE1373_01307 ETECE1441_01272 ETECE1649_01283 ETECE1779_01898 ETECE36_02033 ETECE925_01304 EVY14_04995 EWK56_23160 ExPECSC038_01031 ExPECSC065_04789 EXX06_10635 EXX23_06550 EXX24_12605 EXX53_08315 EXX55_09935 EXX71_04965 EXX87_17545 EYD11_06385 EYV18_00540 EYY27_08925 EYY78_04570 F0L67_03200 F1E19_01995 F6T45_05015 F6T51_12825 F7F11_13545 F7F23_03895 F7F26_02170 F7F56_04735 F7O57_19075 F9B07_15645 F9X20_022945 F9X20_23200 FAF34_016480 FKO60_11360 FNJ67_07505 FNJ69_11070 FORC82_1302 FQ021_17345 FQ915_03000 FQU83_08565 FRV13_24475 FV293_04030 FV295_21285 FV438_06420 FVA71_07625 FVB16_08285 FY127_07070 FZC17_21755 FZN26_05430 FZN30_01555 G3565_12670 G4280_06980 G5603_17790 G5608_06035 G5616_11790 G5632_01725 G5670_00375 G5680_13295 G5688_02560 G5696_04710 G6Z99_06700 G9448_21370 G9P49_06135 G9P50_05805 GE057_06400 GE087_22220 GE096_23795 GE400_18410 GE558_03700 GFY48_07360 GHD50_04265 GIJ01_17190 GJ11_16440 GKF34_12745 GKF39_12770 GKF52_12390 GKF74_15130 GKF86_12610 GKF89_05600 GKG12_07595 GNX12_06635 GNZ05_14260 GP650_11010 GP662_02410 GP666_02375 GP698_19375 GP711_05545 GP720_05435 GP935_11790 GP945_11815 GP946_09830 GP979_03835 GQE33_10145 GQE34_03320 GQE36_02820 GQE42_05195 GQE64_06775 GQF59_04050 GQM04_00470 GQM06_01210 GQM10_01955 GQM13_00370 GQM17_08105 GQM28_13705 GQN24_02690 GQY14_14650 GRC73_00335 GRW02_18930 GRW05_20530 GRW30_01610 GRW57_04020 GRW80_05900 GRW81_02985 GUB08_08130 GUB85_04115 GUB91_01450 GUB95_04140 GUC01_12975 GUC12_04125 GUI16_11235 GUI33_10260 GXC14_11375 H4P50_06130 H4P51_06175 H5C68_05330 H5C80_10710 HCR07_25100 HF523_05810 HFD31_002164 HFD39_000155 HFD59_000124 HFD69_002318 HFU80_000062 HGR17_08420 HGR36_02115 HGR87_14005 HGR88_00335 HGS12_16585 HGS82_10865 HGS97_10410 HGT58_15310 HH117_09155 HH456_001659 HH707_002583 HH814_002531 HHA77_001225 HHG54_001873 HHH24_000348 HHH97_001789 HHJ41_15635 HHJ44_08960 HI055_002120 HI083_000073 HIA56_001207 HIB31_003489 HIO03_000920 HIO61_002670 HIQ74_002353 HIQ82_000253 HIR91_002918 HIT56_001054 HIT59_001165 HIZ62_003246 HJ359_002815 HJ411_002481 HJ802_002389 HJI76_000324 HJM41_000070 HJQ03_000482 HJR60_003324 HJR92_001391 HJS12_001887 HJS53_003062 HJT66_002293 HJU54_002551 HJV81_000400 HK427_001019 HKA14_000350 HKA45_001888 HKA57_001017 HKC58_001840 HL152_19375 HL186_05310 HL465_03490 HL563_06280 HL601_02200 HLI97_000662 HLQ75_09485 HLQ92_00780 HLT96_15740 HLU13_22705 HLU98_15760 HLZ85_08870 HmCms169_04122 HmCmsJML074_00157 HmCmsJML079_04794 HmCmsJML146_04436 HmCmsJML204_01272 HMG20_09480 HMG24_01040 HMG27_02320 HMG35_00780 HMP86_13795 HMP86_24700 HMQ05_19265 HMT01_03775 HMT08_05155 HMT08_28550 HMW26_06975 HMW26_28335 HNC38_16805 HNC38_26545 HNC40_08700 HNC59_19925 HNC73_12675 HNC73_26845 HNC75_00370 HNC75_28345 HNC88_01890 HNC94_05085 HNC99_16600 HND23_06830 HNN81_06815 HNN86_13480 HNO03_06855 HNV44_04820 HNV94_23295 HNX16_07545 HNX34_06275 HP431_20565 HPE49_06455 HPE52_04725 HPM96_16070 HR075_06450 HS093_20230 HV005_05860 HV021_05945 HV022_05945 HV055_06855 HV065_11700 HV098_06660 HV108_06845 HV131_12355 HV152_06500 HV156_20570 HV168_22135 HV188_17445 HV244_06050 HV297_05940 HV303_07215 HV348_06625 HVV38_22800 HVV39_04610 HVV53_09500 HVV70_15750 HVV73_06345 HVV78_16445 HVV92_07105 HVW04_22460 HVW09_17135 HVW11_17730 HVW22_14125 HVW43_23780 HVW44_03515 HVW45_06570 HVW59_20535 HVW60_06025 HVW76_06160 HVW90_20450 HVW93_16120 HVW98_16475 HVX17_06825 HVX22_06165 HVX24_05920 HVX30_17060 HVX33_20380 HVX51_07255 HVX60_22715 HVX73_06315 HVX96_20935 HVY01_06025 HVY79_16580 HVY93_06140 HVZ20_17160 HVZ21_06800 HVZ24_05960 HVZ42_06315 HVZ44_06100 HVZ47_16430 HVZ53_06800 HVZ62_21010 HW43_16985 HX136_06215 HXS78_06390 HZT35_24385 IB283_15985 MJ49_18340 MS6198_28420 MS8345_02710 NCTC10082_03774 NCTC10089_01331 NCTC10090_04389 NCTC10418_02157 NCTC10764_00590 NCTC10767_02608 NCTC10963_01325 NCTC10974_01584 NCTC11022_02579 NCTC11181_03588 NCTC13148_02328 NCTC13216_00585 NCTC13846_01450 NCTC7927_01515 NCTC7928_01351 NCTC8009_03091 NCTC8450_04275 NCTC8621_01414 NCTC8959_02449 NCTC8960_04073 NCTC9007_03629 NCTC9045_01567 NCTC9050_04658 NCTC9055_03306 NCTC9058_00595 NCTC9062_01778 NCTC9073_04529 NCTC9077_01734 NCTC9111_01927 NCTC9117_01908 NCTC9119_01542 NCTC9434_01297 NCTC9703_01077 NCTC9706_04630 NCTC9969_01550 PGD_00721 PU06_05235 RG28_09285 RK56_021870 RX35_01409 SAMEA3472043_01022 SAMEA3472044_02971 SAMEA3472047_01046 SAMEA3472055_00951 SAMEA3472056_00857 SAMEA3472070_00078 SAMEA3472080_01593 SAMEA3472090_01258 SAMEA3472108_03478 SAMEA3472110_00501 SAMEA3472112_00795 SAMEA3472114_03262 SAMEA3472147_00149 SAMEA3484427_00426 SAMEA3484429_00535 SAMEA3484434_00309 SAMEA3485101_04475 SAMEA3752372_01107 SAMEA3752557_00983 SAMEA3752559_00706 SAMEA3752620_00076 SAMEA3753064_03113 SAMEA3753097_02737 SAMEA3753164_00642 SAMEA3753290_03539 SAMEA3753300_01012 SK85_02769 SY51_14470 U14A_02676 UN86_05220 UN91_26580 WP2S18E08_13310 WP4S17E03_12470 WP4S17E08_12740 WP4S18E07_12750 WP4S18E08_12390 WP5S18E08_13060 WP5S18E09_12560 WP7S17E04_11450 WP7S18E09_12930 WQ89_05665 WR15_01255 YDC107_1095] Dual-specificity RNA methyltransferase RlmN (EC 2.1.1.192) (23S rRNA (adenine(2503)-C(2))-methyltransferase) (23S rRNA m2A2503 methyltransferase) (Ribosomal RNA large subunit methyltransferase N) (tRNA (adenine(37)-C(2))-methyltransferase) (tRNA m2A37 methyltransferase)
[CDC25C] M-phase inducer phosphatase 3 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25C)
[CDK11A CDC2L2 CDC2L3 PITSLREB] Cyclin-dependent kinase 11A (EC 2.7.11.22) (Cell division cycle 2-like protein kinase 2) (Cell division protein kinase 11A) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L2)
[Cdk1 Cdc2 Cdc2a Cdkn1] Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase)
[SIW14 OCA3 YNL032W N2746] Inositol phosphatase SIW14 (EC 3.6.1.52) (5-PP-InsP phosphatase) (Inositol pyrophosphate phosphatase SIW14) (Oxidant-induced cell-cycle arrest protein 3) (Synthetic interaction with WHI2 protein 14)
[Cdk11b Cdc2l1 Cdk11] Cyclin-dependent kinase 11B (Cell division cycle 2-like protein kinase 1) (Cell division protein kinase 11) (Cyclin-dependent kinase 11) (EC 2.7.11.22) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L1)

Bibliography :