GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Ubiquitin recognition factor in ER-associated degradation protein 1 (Ubiquitin fusion degradation protein 1) (UB fusion protein 1)

 UFD1_HUMAN              Reviewed;         307 AA.
Q92890; A8MW31; Q9Y5N0;
01-NOV-1997, integrated into UniProtKB/Swiss-Prot.
13-NOV-2007, sequence version 3.
25-MAY-2022, entry version 180.
RecName: Full=Ubiquitin recognition factor in ER-associated degradation protein 1 {ECO:0000312|HGNC:HGNC:12520};
AltName: Full=Ubiquitin fusion degradation protein 1;
Short=UB fusion protein 1;
Name=UFD1 {ECO:0000312|HGNC:HGNC:12520}; Synonyms=UFD1L;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT), AND VARIANT ALA-130.
TISSUE=Brain;
PubMed=9063746; DOI=10.1093/hmg/6.2.259;
Pizzuti A., Novelli G., Ratti A., Amati F., Mari A., Calabrese G.,
Nicolis S., Silani V., Marino B., Scarlato G., Ottolenghi S.,
Dallapiccola B.;
"UFD1L, a developmentally expressed ubiquitination gene, is deleted in
CATCH 22 syndrome.";
Hum. Mol. Genet. 6:259-265(1997).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
TISSUE=Heart;
Gong L., Yeh E.T.H.;
"Characterization of human UFD1, a ubiquitin fusion-degradation protein.";
Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
PubMed=15461802; DOI=10.1186/gb-2004-5-10-r84;
Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A.,
Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J.,
Beare D.M., Dunham I.;
"A genome annotation-driven approach to cloning the human ORFeome.";
Genome Biol. 5:R84.1-R84.11(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Brain;
Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.;
Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=10591208; DOI=10.1038/990031;
Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M.,
Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C.,
Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E.,
Bridgeman A.M., Buck D., Burgess J., Burrill W.D., Burton J., Carder C.,
Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G.,
Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V.,
Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M.,
Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A.,
Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C.,
Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E.,
Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F.,
Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M.,
Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A.,
Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D.,
Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y.,
Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S.,
Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E.,
Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L.,
Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L.,
Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N.,
Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A.,
Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L.,
Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P.,
Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P.,
Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q.,
Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J.,
Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J.,
Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D.,
Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T.,
Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P.,
Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K.,
Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R.,
Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L.,
McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J.,
Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E.,
Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P.,
Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y.,
Wright H.;
"The DNA sequence of human chromosome 22.";
Nature 402:489-495(1999).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
TISSUE=Brain, and Skin;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
INTERACTION WITH NPLOC4.
PubMed=11574150; DOI=10.1016/s0378-1119(01)00649-7;
Botta A., Tandoi C., Fini G., Calabrese G., Dallapiccola B., Novelli G.;
"Cloning and characterization of the gene encoding human NPL4, a protein
interacting with the ubiquitin fusion-degradation protein (UFD1L).";
Gene 275:39-46(2001).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[9]
ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND IDENTIFICATION BY MASS
SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19413330; DOI=10.1021/ac9004309;
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.;
"Lys-N and trypsin cover complementary parts of the phosphoproteome in a
refined SCX-based approach.";
Anal. Chem. 81:4493-4501(2009).
[10]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
[11]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-231; SER-245; SER-247 AND
SER-299, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.;
"Quantitative phosphoproteomics reveals widespread full phosphorylation
site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[12]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T.,
Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[13]
INTERACTION WITH USP13.
PubMed=21571647; DOI=10.1073/pnas.1100028108;
Chen M., Gutierrez G.J., Ronai Z.A.;
"Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER)
stress response to cell cycle control.";
Proc. Natl. Acad. Sci. U.S.A. 108:9119-9124(2011).
[14]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21406692; DOI=10.1126/scisignal.2001570;
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T.,
Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.;
"System-wide temporal characterization of the proteome and phosphoproteome
of human embryonic stem cell differentiation.";
Sci. Signal. 4:RS3-RS3(2011).
[15]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-129; SER-231; SER-245;
SER-247 AND SER-299, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[16]
INTERACTION WITH ZFAND2B.
PubMed=24160817; DOI=10.1042/bj20130710;
Glinka T., Alter J., Braunstein I., Tzach L., Wei Sheng C., Geifman S.,
Edelmann M.J., Kessler B.M., Stanhill A.;
"Signal-peptide-mediated translocation is regulated by a p97-AIRAPL
complex.";
Biochem. J. 457:253-261(2014).
[17]
FUNCTION, AND INTERACTION WITH NPLOC4 AND VCP.
PubMed=26471729; DOI=10.15252/embj.201591888;
Hao Q., Jiao S., Shi Z., Li C., Meng X., Zhang Z., Wang Y., Song X.,
Wang W., Zhang R., Zhao Y., Wong C.C., Zhou Z.;
"A non-canonical role of the p97 complex in RIG-I antiviral signaling.";
EMBO J. 34:2903-2920(2015).
[18]
STRUCTURE BY NMR OF 11-193.
RIKEN structural genomics initiative (RSGI);
"Solution structure of human ubiquitin fusion degradation protein 1 homolog
UFD1.";
Submitted (APR-2008) to the PDB data bank.
-!- FUNCTION: Essential component of the ubiquitin-dependent proteolytic
pathway which degrades ubiquitin fusion proteins. The ternary complex
containing UFD1, VCP and NPLOC4 binds ubiquitinated proteins and is
necessary for the export of misfolded proteins from the ER to the
cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1-
VCP complex regulates spindle disassembly at the end of mitosis and is
necessary for the formation of a closed nuclear envelope. It may be
involved in the development of some ectoderm-derived structures (By
similarity). Acts as a negative regulator of type I interferon
production via the complex formed with VCP and NPLOC4, which binds to
DDX58/RIG-I and recruits RNF125 to promote ubiquitination and
degradation of DDX58/RIG-I (PubMed:26471729).
{ECO:0000250|UniProtKB:Q9ES53, ECO:0000269|PubMed:26471729}.
-!- PATHWAY: Protein degradation; proteasomal ubiquitin-dependent pathway.
{ECO:0000250|UniProtKB:Q9ES53}.
-!- SUBUNIT: Heterodimer with NPLOC4, this heterodimer binds VCP and
inhibits Golgi membrane fusion (PubMed:11574150, PubMed:26471729).
Interacts with USP13 (PubMed:21571647). Interacts with ZFAND2B;
probably through VCP (PubMed:24160817). {ECO:0000269|PubMed:11574150,
ECO:0000269|PubMed:21571647, ECO:0000269|PubMed:24160817,
ECO:0000269|PubMed:26471729}.
-!- INTERACTION:
Q92890; P42858: HTT; NbExp=7; IntAct=EBI-1994090, EBI-466029;
Q92890; Q8TAT6: NPLOC4; NbExp=8; IntAct=EBI-1994090, EBI-1994109;
Q92890; P55072: VCP; NbExp=5; IntAct=EBI-1994090, EBI-355164;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:Q9ES53}.
Cytoplasm, cytosol {ECO:0000250|UniProtKB:Q9ES53}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=Short;
IsoId=Q92890-2; Sequence=Displayed;
Name=Long;
IsoId=Q92890-1; Sequence=VSP_006707;
Name=3;
IsoId=Q92890-3; Sequence=VSP_045044;
-!- TISSUE SPECIFICITY: Found in adult heart, skeletal muscle and pancreas,
and in fetal liver and kidney.
-!- MISCELLANEOUS: [Isoform Short]: Major isoform.
-!- SIMILARITY: Belongs to the UFD1 family. {ECO:0000305}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; U64444; AAD08720.1; -; mRNA.
EMBL; AF141201; AAD28788.1; -; mRNA.
EMBL; CR456607; CAG30493.1; -; mRNA.
EMBL; AK225877; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AC000068; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC000087; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC001049; AAH01049.1; -; mRNA.
EMBL; BC005087; AAH05087.1; -; mRNA.
CCDS; CCDS13761.1; -. [Q92890-2]
CCDS; CCDS33600.2; -. [Q92890-3]
RefSeq; NP_001030324.2; NM_001035247.2. [Q92890-3]
RefSeq; NP_005650.2; NM_005659.6. [Q92890-2]
PDB; 2YUJ; NMR; -; A=11-193.
PDB; 5B6C; X-ray; 1.55 A; B=225-235.
PDB; 5C1B; X-ray; 3.08 A; U/V=221-241.
PDBsum; 2YUJ; -.
PDBsum; 5B6C; -.
PDBsum; 5C1B; -.
AlphaFoldDB; Q92890; -.
SMR; Q92890; -.
BioGRID; 113200; 142.
ComplexPortal; CPX-137; VCP-NPL4-UFD1 AAA ATPase complex.
CORUM; Q92890; -.
DIP; DIP-45954N; -.
IntAct; Q92890; 43.
MINT; Q92890; -.
STRING; 9606.ENSP00000263202; -.
MoonDB; Q92890; Predicted.
GlyGen; Q92890; 1 site, 1 O-linked glycan (1 site).
iPTMnet; Q92890; -.
PhosphoSitePlus; Q92890; -.
BioMuta; UFD1; -.
DMDM; 160332310; -.
OGP; Q92890; -.
EPD; Q92890; -.
jPOST; Q92890; -.
MassIVE; Q92890; -.
MaxQB; Q92890; -.
PaxDb; Q92890; -.
PeptideAtlas; Q92890; -.
PRIDE; Q92890; -.
ProteomicsDB; 2220; -.
ProteomicsDB; 75576; -. [Q92890-2]
ProteomicsDB; 75577; -. [Q92890-1]
Antibodypedia; 22930; 349 antibodies from 32 providers.
DNASU; 7353; -.
Ensembl; ENST00000263202.15; ENSP00000263202.9; ENSG00000070010.19.
Ensembl; ENST00000399523.5; ENSP00000382439.1; ENSG00000070010.19. [Q92890-3]
GeneID; 7353; -.
KEGG; hsa:7353; -.
MANE-Select; ENST00000263202.15; ENSP00000263202.9; NM_005659.7; NP_005650.2.
UCSC; uc002zpm.3; human. [Q92890-2]
CTD; 7353; -.
DisGeNET; 7353; -.
GeneCards; UFD1; -.
HGNC; HGNC:12520; UFD1.
HPA; ENSG00000070010; Low tissue specificity.
MalaCards; UFD1; -.
MIM; 601754; gene.
neXtProt; NX_Q92890; -.
OpenTargets; ENSG00000070010; -.
Orphanet; 567; 22q11.2 deletion syndrome.
PharmGKB; PA37167; -.
VEuPathDB; HostDB:ENSG00000070010; -.
eggNOG; KOG1816; Eukaryota.
GeneTree; ENSGT00390000002408; -.
HOGENOM; CLU_037790_2_0_1; -.
InParanoid; Q92890; -.
OMA; NIEYPMI; -.
PhylomeDB; Q92890; -.
TreeFam; TF314581; -.
PathwayCommons; Q92890; -.
Reactome; R-HSA-110320; Translesion Synthesis by POLH.
Reactome; R-HSA-5689880; Ub-specific processing proteases.
SignaLink; Q92890; -.
SIGNOR; Q92890; -.
UniPathway; UPA00144; -.
BioGRID-ORCS; 7353; 784 hits in 1092 CRISPR screens.
ChiTaRS; UFD1L; human.
EvolutionaryTrace; Q92890; -.
GeneWiki; UFD1L; -.
GenomeRNAi; 7353; -.
Pharos; Q92890; Tbio.
PRO; PR:Q92890; -.
Proteomes; UP000005640; Chromosome 22.
RNAct; Q92890; protein.
Bgee; ENSG00000070010; Expressed in chorionic villus and 242 other tissues.
ExpressionAtlas; Q92890; baseline and differential.
Genevisible; Q92890; HS.
GO; GO:0005829; C:cytosol; IEA:UniProtKB-SubCell.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; HDA:UniProtKB.
GO; GO:0036501; C:UFD1-NPL4 complex; IPI:ParkinsonsUK-UCL.
GO; GO:0034098; C:VCP-NPL4-UFD1 AAA ATPase complex; IDA:UniProtKB.
GO; GO:0036435; F:K48-linked polyubiquitin modification-dependent protein binding; IEA:Ensembl.
GO; GO:0031593; F:polyubiquitin modification-dependent protein binding; IBA:GO_Central.
GO; GO:0004843; F:thiol-dependent deubiquitinase; TAS:ProtInc.
GO; GO:0071712; P:ER-associated misfolded protein catabolic process; IMP:ParkinsonsUK-UCL.
GO; GO:0039536; P:negative regulation of RIG-I signaling pathway; IMP:UniProtKB.
GO; GO:0032480; P:negative regulation of type I interferon production; IMP:UniProtKB.
GO; GO:0030970; P:retrograde protein transport, ER to cytosol; IMP:ParkinsonsUK-UCL.
GO; GO:0001501; P:skeletal system development; TAS:ProtInc.
GO; GO:0030433; P:ubiquitin-dependent ERAD pathway; IBA:GO_Central.
GO; GO:0006511; P:ubiquitin-dependent protein catabolic process; IMP:UniProtKB.
Gene3D; 2.40.40.50; -; 1.
InterPro; IPR004854; Ufd1-like.
InterPro; IPR042299; Ufd1-like_Nn.
PANTHER; PTHR12555; PTHR12555; 1.
Pfam; PF03152; UFD1; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Cytoplasm; Nucleus;
Phosphoprotein; Reference proteome; Ubl conjugation pathway.
CHAIN 1..307
/note="Ubiquitin recognition factor in ER-associated
degradation protein 1"
/id="PRO_0000194984"
REGION 231..258
/note="Disordered"
/evidence="ECO:0000256|SAM:MobiDB-lite"
REGION 288..307
/note="Disordered"
/evidence="ECO:0000256|SAM:MobiDB-lite"
MOD_RES 1
/note="N-acetylmethionine"
/evidence="ECO:0007744|PubMed:19413330"
MOD_RES 129
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:23186163"
MOD_RES 231
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:20068231,
ECO:0007744|PubMed:23186163"
MOD_RES 245
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:20068231,
ECO:0007744|PubMed:23186163"
MOD_RES 247
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:20068231,
ECO:0007744|PubMed:23186163"
MOD_RES 299
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:18669648,
ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231,
ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163"
VAR_SEQ 106
/note="E -> EDGLVQLETVNLQVATYSKSKFCYLPHWMMQNLLLEE (in
isoform Long)"
/evidence="ECO:0000303|PubMed:9063746"
/id="VSP_006707"
VAR_SEQ 267..307
/note="Missing (in isoform 3)"
/evidence="ECO:0000303|Ref.4"
/id="VSP_045044"
VARIANT 130
/note="P -> A (in dbSNP:rs17744624)"
/evidence="ECO:0000269|PubMed:9063746"
/id="VAR_052436"
CONFLICT 25
/note="C -> R (in Ref. 4; AK225877)"
/evidence="ECO:0000305"
CONFLICT 33
/note="G -> W (in Ref. 1; AAD08720)"
/evidence="ECO:0000305"
CONFLICT 183
/note="I -> H (in Ref. 1; AAD08720)"
/evidence="ECO:0000305"
STRAND 16..18
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 20..26
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 31..35
/evidence="ECO:0007829|PDB:2YUJ"
TURN 39..44
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 45..47
/evidence="ECO:0007829|PDB:2YUJ"
HELIX 50..58
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 66..71
/evidence="ECO:0007829|PDB:2YUJ"
TURN 72..75
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 76..84
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 91..93
/evidence="ECO:0007829|PDB:2YUJ"
HELIX 97..102
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 108..115
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 121..129
/evidence="ECO:0007829|PDB:2YUJ"
HELIX 130..134
/evidence="ECO:0007829|PDB:2YUJ"
HELIX 138..146
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 157..164
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 166..181
/evidence="ECO:0007829|PDB:2YUJ"
STRAND 188..191
/evidence="ECO:0007829|PDB:2YUJ"
SEQUENCE 307 AA; 34500 MW; FC69860002C042C6 CRC64;
MFSFNMFDHP IPRVFQNRFS TQYRCFSVSM LAGPNDRSDV EKGGKIIMPP SALDQLSRLN
ITYPMLFKLT NKNSDRMTHC GVLEFVADEG ICYLPHWMMQ NLLLEEGGLV QVESVNLQVA
TYSKFQPQSP DFLDITNPKA VLENALRNFA CLTTGDVIAI NYNEKIYELR VMETKPDKAV
SIIECDMNVD FDAPLGYKEP ERQVQHEEST EGEADHSGYA GELGFRAFSG SGNRLDGKKK
GVEPSPSPIK PGDIKRGIPN YEFKLGKITF IRNSRPLVKK VEEDEAGGRF VAFSGEGQSL
RKKGRKP


Related products :

Catalog number Product name Quantity
EIAAB44926 Mouse,Mus musculus,Ube4b,Ubiquitin conjugation factor E4 B,Ubiquitin fusion degradation protein 2,Ufd2,Ufd2a
EIAAB45257 Homo sapiens,Human,UB fusion protein 1,Ubiquitin fusion degradation protein 1 homolog,UFD1L
EIAAB45256 Mouse,Mus musculus,UB fusion protein 1,Ubiquitin fusion degradation protein 1 homolog,Ufd1l
EIAAB45258 Rat,Rattus norvegicus,UB fusion protein 1,Ubiquitin fusion degradation protein 1 homolog,Ufd1l
EIAAB44925 HDNB1,Homo sapiens,Homozygously deleted in neuroblastoma 1,Human,KIAA0684,UBE4B,Ubiquitin conjugation factor E4 B,Ubiquitin fusion degradation protein 2,UFD2
E3048h Human Ubiquitin Fusion Degradation 1 Like Protein 96T
Y050706 Anti_UFD1L(Ubiquitin fusion degradation protein 1 homolog) 100ug
UFD1_RAT Rat ELISA Kit FOR Ubiquitin fusion degradation protein 1 homolog 96T
E12618h Mouse ELISA Kit FOR Ubiquitin fusion degradation protein 1 homolog 96T
I0220 Ubiquitin fusion degradation protein 1 homolog (UFD1L), Rat, ELISA Kit 96T
CSB-EL025559RA Rat Ubiquitin fusion degradation protein 1 homolog(UFD1L) ELISA kit 96T
CSB-EL025559HU Human Ubiquitin fusion degradation protein 1 homolog(UFD1L) ELISA kit 96T
I0219 Ubiquitin fusion degradation protein 1 homolog (UFD1L), Mouse, ELISA Kit 96T
Y050706 Anti-UFD1L(Ubiquitin fusion degradation protein 1 homolog) Antibody 100ug
CSB-EL025559MO Mouse Ubiquitin fusion degradation protein 1 homolog(UFD1L) ELISA kit 96T
CSB-EL025559RA Rat Ubiquitin fusion degradation protein 1 homolog(UFD1L) ELISA kit SpeciesRat 96T
I0218 Ubiquitin fusion degradation protein 1 homolog (UFD1L), Human, ELISA Kit 96T
CSB-EL025559HU Human Ubiquitin fusion degradation protein 1 homolog(UFD1L) ELISA kit SpeciesHuman 96T
UFD1_RAT ELISA Kit FOR Ubiquitin fusion degradation protein 1 homolog; organism: Rat; gene name: Ufd1l 96T
CSB-EL025559MO Mouse Ubiquitin fusion degradation protein 1 homolog(UFD1L) ELISA kit SpeciesMouse 96T
pro-1625 Recombinant Human Ubiquitin Fusion Degradation 1 Like 2
pro-1625 Recombinant Human Ubiquitin Fusion Degradation 1 Like 10
pro-1625 Recombinant Human Ubiquitin Fusion Degradation 1 Like 1mg
201-20-6241 UFD1L{ubiquitin fusion degradation 1 like (yeast)}rabbit.pAb 0.2ml
GS-2383a ubiquitin fusion degradation 1 like (yeast) primary antibody, Host: Rabbit 200ul