GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Vesicle transport protein SEC20 (BCL2/adenovirus E1B 19 kDa protein-interacting protein 1) (Transformation-related gene 8 protein) (TRG-8)

 SEC20_HUMAN             Reviewed;         228 AA.
Q12981; D3DQM3; D3DQM4; D3DQM5; D3DQM6; O75622; O75623; O75624; Q6K044;
Q96FG4;
15-JUL-1999, integrated into UniProtKB/Swiss-Prot.
18-APR-2006, sequence version 3.
07-APR-2021, entry version 169.
RecName: Full=Vesicle transport protein SEC20;
AltName: Full=BCL2/adenovirus E1B 19 kDa protein-interacting protein 1;
AltName: Full=Transformation-related gene 8 protein;
Short=TRG-8;
Name=BNIP1; Synonyms=NIP1, SEC20L; ORFNames=TRG8;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH BCL2,
AND INTERACTION WITH ADENOVIRUS PROTEIN E1B 19K (MICROBIAL INFECTION).
PubMed=7954800; DOI=10.1016/0092-8674(94)90202-x;
Boyd J.M., Malstrom S., Subramanian T., Venkatesh L.K., Schaeper U.,
Elangovan B., D'Sa-Eipper C., Chinnadurai G.;
"Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of
cellular proteins.";
Cell 79:341-351(1994).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), AND TISSUE SPECIFICITY.
PubMed=10217402; DOI=10.1016/s0014-5793(99)00335-x;
Zhang H., Heim J., Meyhack B.;
"Novel BNIP1 variants and their interaction with BCL2 family members.";
FEBS Lett. 448:23-27(1999).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Kim J.W.;
"Identification of human transformation-related gene.";
Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANT HIS-14.
NIEHS SNPs program;
Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Kidney;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
FUNCTION, INTERACTION WITH NAPA; RINT1; STX18; USE1L AND ZW10, SUBCELLULAR
LOCATION, AND MUTAGENESIS OF LEU-114.
PubMed=15272311; DOI=10.1038/sj.emboj.7600333;
Nakajima K., Hirose H., Taniguchi M., Kurashina H., Arasaki K.,
Nagahama M., Tani K., Yamamoto A., Tagaya M.;
"Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane
fusion.";
EMBO J. 23:3216-3226(2004).
[8]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T.,
Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[9]
FUNCTION IN AUTOPHAGY, INTERACTION WITH RNF185 AND SQSTM1, SUBCELLULAR
LOCATION, AND UBIQUITINATION BY RNF185.
PubMed=21931693; DOI=10.1371/journal.pone.0024367;
Tang F., Wang B., Li N., Wu Y., Jia J., Suo T., Chen Q., Liu Y.J., Tang J.;
"RNF185, a novel mitochondrial ubiquitin E3 ligase, regulates autophagy
through interaction with BNIP1.";
PLoS ONE 6:E24367-E24367(2011).
[10]
FUNCTION, INTERACTION WITH RNF186, SUBCELLULAR LOCATION, AND UBIQUITINATION
BY RNF186.
PubMed=23896122; DOI=10.1016/j.cellsig.2013.07.016;
Wang P., Wu Y., Li Y., Zheng J., Tang J.;
"A novel RING finger E3 ligase RNF186 regulate ER stress-mediated apoptosis
through interaction with BNip1.";
Cell. Signal. 25:2320-2333(2013).
[11]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L.,
Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human liver
phosphoproteome.";
J. Proteomics 96:253-262(2014).
[12]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25944712; DOI=10.1002/pmic.201400617;
Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M., Ayoub D.,
Lane L., Bairoch A., Van Dorsselaer A., Carapito C.;
"N-terminome analysis of the human mitochondrial proteome.";
Proteomics 15:2519-2524(2015).
-!- FUNCTION: As part of a SNARE complex may be involved in endoplasmic
reticulum membranes fusion and be required for the maintenance of
endoplasmic reticulum organization (PubMed:15272311). Plays also a role
in apoptosis (PubMed:7954800, PubMed:15272311, PubMed:23896122). It is
for instance required for endoplasmic reticulum stress-induced
apoptosis (PubMed:23896122). As a substrate of RNF185 interacting with
SQSTM1, might also be involved in mitochondrial autophagy (Probable).
{ECO:0000269|PubMed:15272311, ECO:0000269|PubMed:23896122,
ECO:0000269|PubMed:7954800, ECO:0000305|PubMed:21931693}.
-!- SUBUNIT: Component of a SNARE complex consisting of STX18, USE1L,
BNIP1/SEC20L and SEC22B (PubMed:15272311). Interacts directly with
STX18, RINT1/TIP20L and NAPA (PubMed:15272311). Interacts with ZW10
through RINT1 (PubMed:15272311). Interacts with BCL2 (PubMed:7954800).
Interacts with RNF186 (PubMed:23896122). Interacts with RNF185
(PubMed:21931693). Interacts with SQSTM1; increased by 'Lys-63'-linked
polyubiquitination of BNIP1 (PubMed:21931693).
{ECO:0000269|PubMed:15272311, ECO:0000269|PubMed:21931693,
ECO:0000269|PubMed:23896122, ECO:0000269|PubMed:7954800}.
-!- SUBUNIT: (Microbial infection) Interacts with adenovirus E1B 19K
protein; plays a role in the suppression of cell apoptosis by the viral
protein. {ECO:0000269|PubMed:7954800}.
-!- INTERACTION:
Q12981; P49447: CYB561; NbExp=3; IntAct=EBI-4402847, EBI-8646596;
Q12981; Q9GZR5: ELOVL4; NbExp=3; IntAct=EBI-4402847, EBI-18535450;
Q12981; Q8TBP5: FAM174A; NbExp=3; IntAct=EBI-4402847, EBI-18636064;
Q12981; Q8NBQ5: HSD17B11; NbExp=3; IntAct=EBI-4402847, EBI-1052304;
Q12981; Q8N5M9: JAGN1; NbExp=3; IntAct=EBI-4402847, EBI-10266796;
Q12981; Q9NX47: MARCHF5; NbExp=3; IntAct=EBI-4402847, EBI-2341610;
Q12981; Q86VR2: RETREG3; NbExp=3; IntAct=EBI-4402847, EBI-10192441;
Q12981; Q9NY72: SCN3B; NbExp=3; IntAct=EBI-4402847, EBI-17247926;
Q12981; Q8TBB6: SLC7A14; NbExp=3; IntAct=EBI-4402847, EBI-5235586;
Q12981; P27105: STOM; NbExp=3; IntAct=EBI-4402847, EBI-1211440;
Q12981; Q16623: STX1A; NbExp=3; IntAct=EBI-4402847, EBI-712466;
Q12981; Q96DZ7: TM4SF19; NbExp=3; IntAct=EBI-4402847, EBI-6448756;
Q12981; Q9Y320: TMX2; NbExp=3; IntAct=EBI-4402847, EBI-6447886;
Q12981; Q3ZAQ7: VMA21; NbExp=3; IntAct=EBI-4402847, EBI-1055364;
-!- SUBCELLULAR LOCATION: Endoplasmic reticulum membrane
{ECO:0000269|PubMed:15272311, ECO:0000269|PubMed:23896122}; Single-pass
type IV membrane protein {ECO:0000255}. Mitochondrion membrane
{ECO:0000269|PubMed:21931693, ECO:0000269|PubMed:23896122}; Single-pass
type IV membrane protein {ECO:0000255}. Note=Localization to the
mitochondrion is regulated by RNF186. {ECO:0000269|PubMed:23896122}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Comment=Additional isoforms seem to exist.;
Name=1; Synonyms=BNIP1, S4;
IsoId=Q12981-4; Sequence=Displayed;
Name=2; Synonyms=BNIP1-a, S1;
IsoId=Q12981-2; Sequence=VSP_004330;
Name=3; Synonyms=BNIP1-b, S2;
IsoId=Q12981-1; Sequence=VSP_017901;
Name=4; Synonyms=BNIP1-c, S3;
IsoId=Q12981-3; Sequence=VSP_017901, VSP_004330;
-!- TISSUE SPECIFICITY: Isoform 1 is highly expressed in heart, brain,
liver skeletal muscle and pancreas. Isoform 3 is moderately expressed
in placenta, lung and kidney. Isoform 4 is highly expressed in testis
and small intestine. {ECO:0000269|PubMed:10217402}.
-!- PTM: Polyubiquitinated (PubMed:21931693, PubMed:23896122). 'Lys-63'-
linked polyubiquitination by RNF185 increases the interaction with the
autophagy receptor SQSTM1 (PubMed:21931693). Undergoes 'Lys-29'- and
'Lys-63'-linked polyubiquitination by RNF186 that may regulate BNIP1
localization to the mitochondrion (PubMed:23896122).
{ECO:0000269|PubMed:21931693, ECO:0000269|PubMed:23896122}.
-!- SIMILARITY: Belongs to the SEC20 family. {ECO:0000305}.
-!- WEB RESOURCE: Name=NIEHS-SNPs;
URL="http://egp.gs.washington.edu/data/bnip1/";
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; U15172; AAC00020.1; -; mRNA.
EMBL; AF083956; AAC33124.1; -; mRNA.
EMBL; AF083957; AAC33125.1; -; mRNA.
EMBL; AF083958; AAC33126.1; -; mRNA.
EMBL; AY216799; AAO91805.1; -; mRNA.
EMBL; AY246554; AAO61090.1; -; Genomic_DNA.
EMBL; CH471062; EAW61405.1; -; Genomic_DNA.
EMBL; CH471062; EAW61406.1; -; Genomic_DNA.
EMBL; CH471062; EAW61408.1; -; Genomic_DNA.
EMBL; CH471062; EAW61409.1; -; Genomic_DNA.
EMBL; CH471062; EAW61410.1; -; Genomic_DNA.
EMBL; CH471062; EAW61411.1; -; Genomic_DNA.
EMBL; CH471062; EAW61412.1; -; Genomic_DNA.
EMBL; CH471062; EAW61413.1; -; Genomic_DNA.
EMBL; BC010959; AAH10959.1; -; mRNA.
CCDS; CCDS43400.1; -. [Q12981-2]
CCDS; CCDS4384.1; -. [Q12981-4]
CCDS; CCDS4385.1; -. [Q12981-1]
CCDS; CCDS4386.1; -. [Q12981-3]
PIR; I38863; I38863.
RefSeq; NP_001196.2; NM_001205.2. [Q12981-4]
RefSeq; NP_053581.2; NM_013978.2. [Q12981-2]
RefSeq; NP_053582.2; NM_013979.2. [Q12981-1]
RefSeq; NP_053583.2; NM_013980.2. [Q12981-3]
BioGRID; 107130; 90.
IntAct; Q12981; 41.
MINT; Q12981; -.
iPTMnet; Q12981; -.
MetOSite; Q12981; -.
PhosphoSitePlus; Q12981; -.
BioMuta; BNIP1; -.
DMDM; 93141310; -.
EPD; Q12981; -.
jPOST; Q12981; -.
MassIVE; Q12981; -.
PeptideAtlas; Q12981; -.
PRIDE; Q12981; -.
ProteomicsDB; 59075; -. [Q12981-4]
ProteomicsDB; 59076; -. [Q12981-1]
ProteomicsDB; 59077; -. [Q12981-2]
ProteomicsDB; 59078; -. [Q12981-3]
Antibodypedia; 2356; 513 antibodies.
DNASU; 662; -.
Ensembl; ENST00000231668; ENSP00000231668; ENSG00000113734. [Q12981-1]
Ensembl; ENST00000351486; ENSP00000239215; ENSG00000113734. [Q12981-4]
Ensembl; ENST00000352523; ENSP00000239214; ENSG00000113734. [Q12981-3]
Ensembl; ENST00000393770; ENSP00000377365; ENSG00000113734. [Q12981-2]
GeneID; 662; -.
KEGG; hsa:662; -.
UCSC; uc003mci.5; human. [Q12981-4]
CTD; 662; -.
DisGeNET; 662; -.
GeneCards; BNIP1; -.
HGNC; HGNC:1082; BNIP1.
HPA; ENSG00000113734; Low tissue specificity.
MIM; 603291; gene.
neXtProt; NX_Q12981; -.
OpenTargets; ENSG00000113734; -.
PharmGKB; PA25392; -.
VEuPathDB; HostDB:ENSG00000113734.17; -.
GeneTree; ENSGT00390000014412; -.
HOGENOM; CLU_105902_0_0_1; -.
InParanoid; Q12981; -.
OMA; CVFYIVQ; -.
OrthoDB; 1328108at2759; -.
PhylomeDB; Q12981; -.
TreeFam; TF324339; -.
PathwayCommons; Q12981; -.
Reactome; R-HSA-6811434; COPI-dependent Golgi-to-ER retrograde traffic.
BioGRID-ORCS; 662; 391 hits in 1002 CRISPR screens.
ChiTaRS; BNIP1; human.
GenomeRNAi; 662; -.
Pharos; Q12981; Tbio.
PRO; PR:Q12981; -.
Proteomes; UP000005640; Chromosome 5.
RNAct; Q12981; protein.
Bgee; ENSG00000113734; Expressed in secondary oocyte and 194 other tissues.
ExpressionAtlas; Q12981; baseline and differential.
Genevisible; Q12981; HS.
GO; GO:0030137; C:COPI-coated vesicle; IEA:Ensembl.
GO; GO:0005737; C:cytoplasm; IDA:MGI.
GO; GO:0005783; C:endoplasmic reticulum; IDA:HGNC-UCL.
GO; GO:0005789; C:endoplasmic reticulum membrane; IDA:UniProtKB.
GO; GO:0030176; C:integral component of endoplasmic reticulum membrane; TAS:HGNC-UCL.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:UniProtKB.
GO; GO:0031966; C:mitochondrial membrane; IDA:UniProtKB.
GO; GO:0005635; C:nuclear envelope; IDA:UniProtKB.
GO; GO:0031201; C:SNARE complex; IDA:HGNC-UCL.
GO; GO:0005484; F:SNAP receptor activity; IDA:FlyBase.
GO; GO:0006915; P:apoptotic process; IPI:MGI.
GO; GO:0016320; P:endoplasmic reticulum membrane fusion; IMP:HGNC-UCL.
GO; GO:0007029; P:endoplasmic reticulum organization; IMP:HGNC-UCL.
GO; GO:0097194; P:execution phase of apoptosis; IC:BHF-UCL.
GO; GO:0043066; P:negative regulation of apoptotic process; TAS:UniProtKB.
GO; GO:0014823; P:response to activity; IEA:Ensembl.
GO; GO:0090649; P:response to oxygen-glucose deprivation; IEA:Ensembl.
GO; GO:0042594; P:response to starvation; IEA:Ensembl.
GO; GO:0006890; P:retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum; IBA:GO_Central.
GO; GO:0016032; P:viral process; IEA:UniProtKB-KW.
InterPro; IPR005606; Sec20.
PANTHER; PTHR12825; PTHR12825; 1.
Pfam; PF03908; Sec20; 1.
1: Evidence at protein level;
Alternative splicing; Apoptosis; Coiled coil; Endoplasmic reticulum;
ER-Golgi transport; Host-virus interaction; Membrane; Mitochondrion;
Reference proteome; Transmembrane; Transmembrane helix; Transport;
Ubl conjugation.
CHAIN 1..228
/note="Vesicle transport protein SEC20"
/id="PRO_0000064960"
TOPO_DOM 1..199
/note="Cytoplasmic"
/evidence="ECO:0000255"
TRANSMEM 200..220
/note="Helical; Anchor for type IV membrane protein"
/evidence="ECO:0000255"
TOPO_DOM 221..228
/note="Lumenal"
/evidence="ECO:0000255"
COILED 37..90
/evidence="ECO:0000255"
VAR_SEQ 59
/note="Q -> QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS
(in isoform 3 and isoform 4)"
/evidence="ECO:0000303|PubMed:10217402"
/id="VSP_017901"
VAR_SEQ 90..123
/note="Missing (in isoform 2 and isoform 4)"
/evidence="ECO:0000303|PubMed:10217402"
/id="VSP_004330"
VARIANT 14
/note="Q -> H (in dbSNP:rs5745100)"
/evidence="ECO:0000269|Ref.4"
/id="VAR_019169"
MUTAGEN 114
/note="L->A: Loss of proapoptotic effect. No effect on
interaction with RINT1."
/evidence="ECO:0000269|PubMed:15272311"
CONFLICT 14
/note="Q -> R (in Ref. 3; AAO91805)"
/evidence="ECO:0000305"
CONFLICT 66
/note="K -> E (in Ref. 3; AAO91805)"
/evidence="ECO:0000305"
CONFLICT 210
/note="A -> R (in Ref. 1 and 2)"
/evidence="ECO:0000305"
SEQUENCE 228 AA; 26132 MW; 23F4C21E7327DE3D CRC64;
MAAPQDVHVR ICNQEIVKFD LEVKALIQDI RDCSGPLSAL TELNTKVKEK FQQLRHRIQD
LEQLAKEQDK ESEKQLLLQE VENHKKQMLS NQASWRKANL TCKIAIDNLE KAELLQGGDL
LRQRKTTKES LAQTSSTITE SLMGISRMMA QQVQQSEEAM QSLVTSSRTI LDANEEFKSM
SGTIQLGRKL ITKYNRRELT DKLLIFLALA LFLATVLYIV KKRLFPFL


Related products :

Catalog number Product name Quantity
EIAAB37780 BCL2_adenovirus E1B 19 kDa protein-interacting protein 1,BNIP1,Homo sapiens,Human,NIP1,SEC20L,Transformation-related gene 8 protein,TRG8,TRG-8,Vesicle transport protein SEC20
EIAAB37781 Bnip1,Mouse,Mus musculus,Sec20,Sec20l,Vesicle transport protein SEC20
SEC20_RAT ELISA Kit FOR Vesicle transport protein SEC20; organism: Rat; gene name: Bnip1 96T
CSB-EL002764RA Rat Vesicle transport protein SEC20(BNIP1) ELISA kit 96T
I2254 Vesicle transport protein SEC20 (BNIP1), Rat, ELISA Kit 96T
SEC20_HUMAN Human ELISA Kit FOR Vesicle transport protein SEC20 96T
BNIP3_HUMAN ELISA Kit FOR BCL2 per adenovirus E1B 19 kDa protein-interacting protein 3; organism: Human; gene name: BNIP3 96T
BNI3L_BOVIN ELISA Kit FOR BCL2 per adenovirus E1B 19 kDa protein-interacting protein 3-like; organism: Bovine; gene name: BNIP3L 96T
BNIP3_BOVIN ELISA Kit FOR BCL2 per adenovirus E1B 19 kDa protein-interacting protein 3; organism: Bovine; gene name: BNIP3 96T
BNIP2_HUMAN ELISA Kit FOR BCL2 per adenovirus E1B 19 kDa protein-interacting protein 2; organism: Human; gene name: BNIP2 96T
BNI3L_HUMAN ELISA Kit FOR BCL2 per adenovirus E1B 19 kDa protein-interacting protein 3-like; organism: Human; gene name: BNIP3L 96T
CSB-EL002764MO Mouse Vesicle transport protein SEC20(BNIP1) ELISA kit 96T
I2253 Vesicle transport protein SEC20 (BNIP1), Mouse, ELISA Kit 96T
CSB-EL002764HU Human Vesicle transport protein SEC20(BNIP1) ELISA kit 96T
CSB-EL002764RA Rat Vesicle transport protein SEC20(BNIP1) ELISA kit SpeciesRat 96T
I2252 Vesicle transport protein SEC20 (BNIP1), Human, ELISA Kit 96T
CSB-EL002764MO Mouse Vesicle transport protein SEC20(BNIP1) ELISA kit SpeciesMouse 96T
CSB-EL002764HU Human Vesicle transport protein SEC20(BNIP1) ELISA kit SpeciesHuman 96T
EIAAB37779 Bnip1,Rat,Rattus norvegicus,Sec20l,Vesicle transport protein SEC20
EIAAB29586 Mouse,Mus musculus,p53-induced gene 11 protein,Pig11,Tp53i11,Transformation related protein 53 inducible protein 11,Trp53i11,Tumor protein p53-inducible protein 11
EIAAB37415 Protein transport protein Sec31A,Rat,Rattus norvegicus,Sec31a,Sec31l1,SEC31-like protein 1,SEC31-related protein A,Vap1,Vesicle-associated protein 1
CSB-EL002767HU Human BCL2 per adenovirus E1B 19 kDa protein-interacting protein 3-like(BNIP3L) ELISA kit 96T
E1419m Mouse ELISA Kit FOR BCL2 per adenovirus E1B 19 kDa protein-interacting protein 3 96T
CD43 Human BCL2 Adenovirus E1B 19 kDa Protein-Interacting Protein 3 BNIP3 50
CF87 Human BCL2 Adenovirus E1B 19 kDa Protein-Interacting Protein 3 BNIP3 l0
Pathways :
WP2199: Seed Development
WP2272: Pathogenic Escherichia coli infection
WP1689: Porphyrin and chlorophyll metabolism
WP1713: Two-component system
WP731: Sterol regulatory element binding protein related
WP1438: Influenza A virus infection
WP1502: Mitochondrial biogenesis
WP1616: ABC transporters
WP1694: Pyrimidine metabolism
WP1657: Glycerolipid metabolism
WP1909: Signal regulatory protein (SIRP) family interactions
WP1663: Homologous recombination
WP1165: G Protein Signaling Pathways
WP1714: Tyrosine metabolism
WP1049: G Protein Signaling Pathways
WP1673: Naphthalene and anthracene degradation
WP1939: Unfolded Protein Response
WP1678: Nucleotide excision repair
WP35: G Protein Signaling Pathways
WP1613: 1,4-Dichlorobenzene degradation
WP2324: AGE/RAGE pathway
WP1625: Base excision repair
WP2371: Parkinsons Disease Pathway
WP1693: Purine metabolism
WP1654: gamma-Hexachlorocyclohexane degradation

Related Genes :
[BNIP3L BNIP3A BNIP3H NIX] BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (Adenovirus E1B19K-binding protein B5) (BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A) (NIP3-like protein X) (NIP3L)
[BECN1 GT197] Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]
[Becn1] Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]
[] E1B 55 kDa protein (E1B-55K) (E1B protein, large T-antigen) (E1B-495R)
[BIK NBK] Bcl-2-interacting killer (Apoptosis inducer NBK) (BIP1) (BP4)
[Becn1] Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]
[BAK1 BAK BCL2L7 CDN1] Bcl-2 homologous antagonist/killer (Apoptosis regulator BAK) (Bcl-2-like protein 7) (Bcl2-L-7)
[BAX BCL2L4] Apoptosis regulator BAX (Bcl-2-like protein 4) (Bcl2-L-4)
[Bcl2l11 Bim Bod] Bcl-2-like protein 11 (Bcl2-L-11) (Bcl-2-related ovarian death protein) (Bcl2-interacting mediator of cell death)
[MCL1 BCL2L3] Induced myeloid leukemia cell differentiation protein Mcl-1 (Bcl-2-like protein 3) (Bcl2-L-3) (Bcl-2-related protein EAT/mcl1) (mcl1/EAT)
[BCL2L11 BIM] Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)
[BCL2L1 BCL2L BCLX] Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[] E1B protein, small T-antigen (E1B 19 kDa protein) (E1B-19K)
[BCL2A1 BCL2L5 BFL1 GRS HBPA1] Bcl-2-related protein A1 (Bcl-2-like protein 5) (Bcl2-L-5) (Hemopoietic-specific early response protein) (Protein BFL-1) (Protein GRS)
[BAD BBC6 BCL2L8] Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-2-like protein 8) (Bcl2-L-8) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)
[Bcl2l11 Bim] Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)
[BOK BCL2L9] Bcl-2-related ovarian killer protein (hBOK) (Bcl-2-like protein 9) (Bcl2-L-9)
[Mcl1] Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Bcl-2-related protein EAT/mcl1)
[E1B] E1B protein, small T-antigen (E1B 19 kDa protein) (E1B-19K) (E1B-175R)
[DYNLL1 DLC1 DNCL1 DNCLC1 HDLC1] Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)
[Bcl2l1 Bcl2l Bclx] Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)
[BAG3 BIS] BAG family molecular chaperone regulator 3 (BAG-3) (Bcl-2-associated athanogene 3) (Bcl-2-binding protein Bis) (Docking protein CAIR-1)
[RRAGA] Ras-related GTP-binding protein A (Rag A) (RagA) (EC 3.6.5.-) (Adenovirus E3 14.7 kDa-interacting protein 1) (FIP-1)
[SEC20 YDR498C D9719.4] Protein transport protein SEC20
[HSPA8 HSC70 HSP73 HSPA10] Heat shock cognate 71 kDa protein (EC 3.6.4.10) (Heat shock 70 kDa protein 8) (Lipopolysaccharide-associated protein 1) (LAP-1) (LPS-associated protein 1)
[Bcl2l1 Bclx Blc2l] Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)
[BCL2] Apoptosis regulator Bcl-2
[BCL2L13 MIL1 CD003] Bcl-2-like protein 13 (Bcl2-L-13) (Bcl-rambo) (Protein Mil1)
[E1B] E1B 55 kDa protein (E1B-55K) (E1B protein, large T-antigen) (E1B-495R)

Bibliography :