GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

WNT1-inducible-signaling pathway protein 1 (WISP-1) (CCN family member 4) (Wnt-1-induced secreted protein)

 WISP1_HUMAN             Reviewed;         367 AA.
O95388; A8KAG6; E7EMM5; Q5JBS6; Q5JBS7; Q5JBS8; Q9HCS3;
15-AUG-2003, integrated into UniProtKB/Swiss-Prot.
01-MAY-1999, sequence version 1.
31-JUL-2019, entry version 167.
RecName: Full=WNT1-inducible-signaling pathway protein 1;
Short=WISP-1;
AltName: Full=CCN family member 4;
AltName: Full=Wnt-1-induced secreted protein;
Flags: Precursor;
Name=WISP1; Synonyms=CCN4;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Fetal kidney, and Lung;
PubMed=9843955; DOI=10.1073/pnas.95.25.14717;
Pennica D., Swanson T.A., Welsh J.W., Roy M.A., Lawrence D.A., Lee J.,
Brush J., Taneyhill L.A., Deuel B., Lew M., Watanabe C., Cohen R.L.,
Melham M.F., Finley G.G., Quirke P., Goddard A.D., Hillan K.J.,
Gurney A.L., Botstein D., Levine A.J.;
"WISP genes are members of the connective tissue growth factor family
that are up-regulated in wnt-1-transformed cells and aberrantly
expressed in human colon tumors.";
Proc. Natl. Acad. Sci. U.S.A. 95:14717-14722(1998).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
TISSUE=Gastric carcinoma;
PubMed=11571650; DOI=10.1038/sj.onc.1204723;
Tanaka S., Sugimachi K., Saeki H., Kinoshita J., Ohga T., Shimada M.,
Maehara Y., Sugimachi K.;
"A novel variant of WISP1 lacking a Von Willebrand type C module
overexpressed in scirrhous gastric carcinoma.";
Oncogene 20:5525-5532(2001).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4 AND 5).
Li Z., Chiao P.J., Evans D.B.;
"Multiple alternatively spliced variants of WISP1 are overexpressed in
pancreatic cancer.";
Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
TISSUE=Synovium, and Uterus;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16421571; DOI=10.1038/nature04406;
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S.,
Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A.,
Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X.,
Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T.,
Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K.,
DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G.,
Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B.,
Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P.,
Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H.,
Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C.,
O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K.,
Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R.,
Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K.,
Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q.,
Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N.,
Lander E.S.;
"DNA sequence and analysis of human chromosome 8.";
Nature 439:331-335(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
FUNCTION IN WNT1 SIGNALING.
PubMed=10716946;
Xu L., Corcoran R.B., Welsh J.W., Pennica D., Levine A.J.;
"WISP-1 is a Wnt-1- and beta-catenin-responsive oncogene.";
Genes Dev. 14:585-595(2000).
[9]
FUNCTION IN TP53-MEDIATED APOPTOSIS.
PubMed=11782444; DOI=10.1101/gad.942902;
Su F., Overholtzer M., Besser D., Levine A.J.;
"WISP-1 attenuates p53-mediated apoptosis in response to DNA damage
through activation of the Akt kinase.";
Genes Dev. 16:46-57(2002).
[10]
INTERACTION WITH DECORIN AND BIGLYCAN.
PubMed=11598131; DOI=10.1074/jbc.M108339200;
Desnoyers L., Arnott D., Pennica D.;
"WISP-1 binds to decorin and biglycan.";
J. Biol. Chem. 276:47599-47607(2001).
-!- FUNCTION: Downstream regulator in the Wnt/Frizzled-signaling
pathway. Associated with cell survival. Attenuates p53-mediated
apoptosis in response to DNA damage through activation of AKT
kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres
to skin and melanoma fibroblasts. In vitro binding to skin
fibroblasts occurs through the proteoglycans, decorin and
biglycan. {ECO:0000269|PubMed:10716946,
ECO:0000269|PubMed:11782444}.
-!- SUBCELLULAR LOCATION: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1;
IsoId=O95388-1; Sequence=Displayed;
Name=2; Synonyms=WISP1v;
IsoId=O95388-2; Sequence=VSP_008008, VSP_008009;
Name=3;
IsoId=O95388-3; Sequence=VSP_042010;
Name=4;
IsoId=O95388-4; Sequence=VSP_045958, VSP_045959;
Note=Ref.3 (AAP43926) sequence is in conflict in position:
155:Q->QQVLHPLQV. {ECO:0000305};
Name=5;
IsoId=O95388-5; Sequence=VSP_047706, VSP_047707;
-!- TISSUE SPECIFICITY: Expressed in heart, kidney, lung, pancreas,
placenta, ovary, small intestine and spleen. Isoform 2 is
expressed predominantly in scirrhous gastric carcinoma and, weakly
in placenta. Overexpression is associated with several cancers
including breast cancer and colon tumors. Isoform 2 is
overexpressed in scirrhous gastric carcinoma.
-!- SIMILARITY: Belongs to the CCN family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF100779; AAC96321.1; -; mRNA.
EMBL; AB034725; BAB17849.1; -; mRNA.
EMBL; AY196486; AAP43924.1; -; mRNA.
EMBL; AY196487; AAP43925.1; -; mRNA.
EMBL; AY196488; AAP43926.1; -; mRNA.
EMBL; AK293031; BAF85720.1; -; mRNA.
EMBL; AK301508; BAG63017.1; -; mRNA.
EMBL; AF192304; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471060; EAW92162.1; -; Genomic_DNA.
EMBL; BC074840; AAH74840.1; -; mRNA.
EMBL; BC074841; AAH74841.1; -; mRNA.
CCDS; CCDS56555.1; -. [O95388-4]
CCDS; CCDS56556.1; -. [O95388-3]
CCDS; CCDS6371.1; -. [O95388-1]
CCDS; CCDS6372.1; -. [O95388-2]
RefSeq; NP_001191798.1; NM_001204869.1. [O95388-4]
RefSeq; NP_001191799.1; NM_001204870.1. [O95388-3]
RefSeq; NP_003873.1; NM_003882.3. [O95388-1]
RefSeq; NP_543028.1; NM_080838.2. [O95388-2]
SMR; O95388; -.
BioGrid; 114367; 2.
IntAct; O95388; 3.
STRING; 9606.ENSP00000250160; -.
iPTMnet; O95388; -.
PhosphoSitePlus; O95388; -.
BioMuta; WISP1; -.
PaxDb; O95388; -.
PeptideAtlas; O95388; -.
PRIDE; O95388; -.
ProteomicsDB; 16974; -.
ProteomicsDB; 50837; -. [O95388-1]
ProteomicsDB; 50838; -. [O95388-2]
ProteomicsDB; 50839; -. [O95388-3]
ProteomicsDB; 62990; -.
DNASU; 8840; -.
Ensembl; ENST00000220856; ENSP00000220856; ENSG00000104415. [O95388-2]
Ensembl; ENST00000250160; ENSP00000250160; ENSG00000104415. [O95388-1]
Ensembl; ENST00000517423; ENSP00000427744; ENSG00000104415. [O95388-4]
Ensembl; ENST00000519433; ENSP00000429185; ENSG00000104415. [O95388-3]
GeneID; 8840; -.
KEGG; hsa:8840; -.
UCSC; uc003yub.4; human. [O95388-1]
CTD; 8840; -.
DisGeNET; 8840; -.
GeneCards; WISP1; -.
HGNC; HGNC:12769; WISP1.
HPA; CAB012205; -.
HPA; HPA007121; -.
MIM; 603398; gene.
neXtProt; NX_O95388; -.
OpenTargets; ENSG00000104415; -.
PharmGKB; PA37372; -.
eggNOG; ENOG410IH8M; Eukaryota.
eggNOG; ENOG410ZWR5; LUCA.
GeneTree; ENSGT00940000158587; -.
HOGENOM; HOG000231462; -.
InParanoid; O95388; -.
KO; K22471; -.
OMA; GEVEPWH; -.
OrthoDB; 601212at2759; -.
PhylomeDB; O95388; -.
TreeFam; TF326070; -.
SIGNOR; O95388; -.
ChiTaRS; WISP1; human.
GeneWiki; WNT1-inducible-signaling_pathway_protein_1; -.
GenomeRNAi; 8840; -.
PRO; PR:O95388; -.
Proteomes; UP000005640; Chromosome 8.
Bgee; ENSG00000104415; Expressed in 124 organ(s), highest expression level in metanephros.
ExpressionAtlas; O95388; baseline and differential.
Genevisible; O95388; HS.
GO; GO:0005829; C:cytosol; IDA:HPA.
GO; GO:0031012; C:extracellular matrix; IBA:GO_Central.
GO; GO:0005615; C:extracellular space; IDA:UniProtKB.
GO; GO:0008201; F:heparin binding; IBA:GO_Central.
GO; GO:0005520; F:insulin-like growth factor binding; IEA:InterPro.
GO; GO:0005178; F:integrin binding; IBA:GO_Central.
GO; GO:0060348; P:bone development; IEA:Ensembl.
GO; GO:0007155; P:cell adhesion; IBA:GO_Central.
GO; GO:0007267; P:cell-cell signaling; TAS:ProtInc.
GO; GO:0042593; P:glucose homeostasis; IEA:Ensembl.
GO; GO:0060548; P:negative regulation of cell death; IBA:GO_Central.
GO; GO:0032331; P:negative regulation of chondrocyte differentiation; IEA:Ensembl.
GO; GO:0045599; P:negative regulation of fat cell differentiation; IEA:Ensembl.
GO; GO:0001649; P:osteoblast differentiation; IEA:Ensembl.
GO; GO:0030316; P:osteoclast differentiation; IEA:Ensembl.
GO; GO:0050729; P:positive regulation of inflammatory response; IDA:UniProtKB.
GO; GO:0045669; P:positive regulation of osteoblast differentiation; IMP:UniProtKB.
GO; GO:0014911; P:positive regulation of smooth muscle cell migration; ISS:UniProtKB.
GO; GO:0048661; P:positive regulation of smooth muscle cell proliferation; ISS:UniProtKB.
GO; GO:0030177; P:positive regulation of Wnt signaling pathway; IEA:Ensembl.
GO; GO:0090303; P:positive regulation of wound healing; IEA:Ensembl.
GO; GO:0050707; P:regulation of cytokine secretion; IDA:UniProtKB.
GO; GO:0007165; P:signal transduction; TAS:ProtInc.
GO; GO:0016055; P:Wnt signaling pathway; IEA:UniProtKB-KW.
Gene3D; 2.20.100.10; -; 1.
InterPro; IPR006207; Cys_knot_C.
InterPro; IPR006208; Glyco_hormone_CN.
InterPro; IPR009030; Growth_fac_rcpt_cys_sf.
InterPro; IPR000867; IGFBP-like.
InterPro; IPR012395; IGFBP_CNN.
InterPro; IPR017891; Insulin_GF-bd_Cys-rich_CS.
InterPro; IPR000884; TSP1_rpt.
InterPro; IPR036383; TSP1_rpt_sf.
InterPro; IPR001007; VWF_dom.
Pfam; PF00007; Cys_knot; 1.
Pfam; PF00219; IGFBP; 1.
Pfam; PF00090; TSP_1; 1.
Pfam; PF00093; VWC; 1.
PIRSF; PIRSF036495; IGFBP_rP_CNN; 1.
SMART; SM00041; CT; 1.
SMART; SM00121; IB; 1.
SMART; SM00209; TSP1; 1.
SMART; SM00214; VWC; 1.
SUPFAM; SSF57184; SSF57184; 1.
SUPFAM; SSF82895; SSF82895; 1.
PROSITE; PS01185; CTCK_1; 1.
PROSITE; PS01225; CTCK_2; 1.
PROSITE; PS00222; IGFBP_N_1; 1.
PROSITE; PS51323; IGFBP_N_2; 1.
PROSITE; PS50092; TSP1; 1.
PROSITE; PS01208; VWFC_1; 1.
PROSITE; PS50184; VWFC_2; 1.
1: Evidence at protein level;
Alternative splicing; Cell adhesion; Complete proteome;
Disulfide bond; Glycoprotein; Polymorphism; Proto-oncogene;
Reference proteome; Secreted; Signal; Wnt signaling pathway.
SIGNAL 1 22 {ECO:0000255}.
CHAIN 23 367 WNT1-inducible-signaling pathway protein
1.
/FTId=PRO_0000014406.
DOMAIN 40 118 IGFBP N-terminal. {ECO:0000255|PROSITE-
ProRule:PRU00653}.
DOMAIN 121 186 VWFC. {ECO:0000255|PROSITE-
ProRule:PRU00220}.
DOMAIN 215 260 TSP type-1. {ECO:0000255|PROSITE-
ProRule:PRU00210}.
DOMAIN 273 347 CTCK. {ECO:0000255|PROSITE-
ProRule:PRU00039}.
CARBOHYD 86 86 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 143 143 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 284 284 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 343 343 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 273 310 {ECO:0000250}.
DISULFID 290 324 {ECO:0000250}.
DISULFID 301 340 {ECO:0000250}.
DISULFID 304 342 {ECO:0000250}.
DISULFID 309 346 {ECO:0000250}.
VAR_SEQ 1 31 MRWFLPWTLAAVTAAAASTVLATALSPAPTT -> MPVPLT
SRHEVVPALDAGSSDSSSRQHRPGH (in isoform 5).
{ECO:0000303|PubMed:14702039,
ECO:0000303|Ref.3}.
/FTId=VSP_047706.
VAR_SEQ 24 268 Missing (in isoform 3).
{ECO:0000303|Ref.3}.
/FTId=VSP_042010.
VAR_SEQ 32 203 Missing (in isoform 5).
{ECO:0000303|PubMed:14702039,
ECO:0000303|Ref.3}.
/FTId=VSP_047707.
VAR_SEQ 117 155 QVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTP
-> RREEVSGCVPARGIHELHTCGLHQHTLLSTQVLWSLHG
Q (in isoform 4). {ECO:0000303|Ref.3}.
/FTId=VSP_045958.
VAR_SEQ 117 117 Q -> H (in isoform 2).
{ECO:0000303|PubMed:11571650}.
/FTId=VSP_008008.
VAR_SEQ 118 204 Missing (in isoform 2).
{ECO:0000303|PubMed:11571650}.
/FTId=VSP_008009.
VAR_SEQ 156 367 Missing (in isoform 4).
{ECO:0000303|Ref.3}.
/FTId=VSP_045959.
VARIANT 205 205 A -> S (in dbSNP:rs35513885).
/FTId=VAR_061265.
CONFLICT 91 91 A -> V (in Ref. 3; AAP43926).
{ECO:0000305}.
SEQUENCE 367 AA; 40331 MW; 9F29CA94D69C0502 CRC64;
MRWFLPWTLA AVTAAAASTV LATALSPAPT TMDFTPAPLE DTSSRPQFCK WPCECPPSPP
RCPLGVSLIT DGCECCKMCA QQLGDNCTEA AICDPHRGLY CDYSGDRPRY AIGVCAQVVG
VGCVLDGVRY NNGQSFQPNC KYNCTCIDGA VGCTPLCLRV RPPRLWCPHP RRVSIPGHCC
EQWVCEDDAK RPRKTAPRDT GAFDAVGEVE AWHRNCIAYT SPWSPCSTSC GLGVSTRISN
VNAQCWPEQE SRLCNLRPCD VDIHTLIKAG KKCLAVYQPE ASMNFTLAGC ISTRSYQPKY
CGVCMDNRCC IPYKSKTIDV SFQCPDGLGF SRQVLWINAC FCNLSCRNPN DIFADLESYP
DFSEIAN


Related products :

Catalog number Product name Quantity
EIAAB46370 CCN family member 4,CCN4,Homo sapiens,Human,WISP1,WISP-1,Wnt-1-induced secreted protein,WNT1-inducible-signaling pathway protein 1
EIAAB46369 CCN family member 4,Ccn4,Elm1,ELM-1,Rat,Rattus norvegicus,Wisp1,WISP-1,WNT1-inducible-signaling pathway protein 1
EIAAB46371 CCN family member 4,Ccn4,Elm1,ELM-1,Mouse,Mus musculus,Wisp1,WISP-1,WNT1-inducible-signaling pathway protein 1
U2153r CLIA CCN family member 5,CCN family protein COP-1,Ccn5,Connective tissue growth factor-like protein,Cop1,Ctgfl,CTGF-L,Rat,Rattus norvegicus,Wisp2,WISP-2,WNT1-inducible-signaling pathway protein 2 96T
U2153r CLIA kit CCN family member 5,CCN family protein COP-1,Ccn5,Connective tissue growth factor-like protein,Cop1,Ctgfl,CTGF-L,Rat,Rattus norvegicus,Wisp2,WISP-2,WNT1-inducible-signaling pathway protein 2 96T
E2153r ELISA CCN family member 5,CCN family protein COP-1,Ccn5,Connective tissue growth factor-like protein,Cop1,Ctgfl,CTGF-L,Rat,Rattus norvegicus,Wisp2,WISP-2,WNT1-inducible-signaling pathway protein 2 96T
E2153r ELISA kit CCN family member 5,CCN family protein COP-1,Ccn5,Connective tissue growth factor-like protein,Cop1,Ctgfl,CTGF-L,Rat,Rattus norvegicus,Wisp2,WISP-2,WNT1-inducible-signaling pathway protein 96T
EIAAB46372 CCN family member 6,CCN6,Homo sapiens,Human,UNQ462_PRO790_PRO956,WISP3,WISP-3,WNT1-inducible-signaling pathway protein 3
U2153m CLIA kit CCN family member 5,Ccn5,Connective tissue growth factor-like protein,Ctgfl,CTGF-L,Mouse,Mus musculus,Wisp2,WISP-2,WNT1-inducible-signaling pathway protein 2 96T
E2153m ELISA kit CCN family member 5,Ccn5,Connective tissue growth factor-like protein,Ctgfl,CTGF-L,Mouse,Mus musculus,Wisp2,WISP-2,WNT1-inducible-signaling pathway protein 2 96T
E2153m ELISA CCN family member 5,Ccn5,Connective tissue growth factor-like protein,Ctgfl,CTGF-L,Mouse,Mus musculus,Wisp2,WISP-2,WNT1-inducible-signaling pathway protein 2 96T
U2153m CLIA CCN family member 5,Ccn5,Connective tissue growth factor-like protein,Ctgfl,CTGF-L,Mouse,Mus musculus,Wisp2,WISP-2,WNT1-inducible-signaling pathway protein 2 96T
E12937h Human WNT1 Inducible Signaling Pathway Protein 1 E 96T
ER158 WNT1-inducible-signaling pathway protein 1 Elisa Kit 96T
E02W0001 Rat WNT1 Inducible Signaling Pathway Protein 1 ELISA 96T/kit
E12936h Human WNT1 Inducible Signaling Pathway Protein 3 E 96T
EM207 WNT1-inducible-signaling pathway protein 1 Elisa Kit 96T
EH928 WNT1-inducible-signaling pathway protein 3 Elisa Kit 96T
EH1267 WNT1-inducible-signaling pathway protein 1 Elisa Kit 96T
EM734 WNT1-inducible-signaling pathway protein 2 Elisa Kit 96T
EH330 WNT1-inducible-signaling pathway protein 1 Elisa Kit 96T
UB-E10419 Rat WNT1 Inducible Signaling Pathway Protein 2(WISP2)ELISA Kit 96T
E07W0001 Porcine WNT1 Inducible Signaling Pathway Protein 1 ELISA 96T/kit
UB-E10420 Rat WNT1 Inducible Signaling Pathway Protein 1(WISP1)ELISA Kit 96T
E12412033 Rat WNT1 Inducible Signaling Pathway Protein 2 (WISP2) ELISA Kit 1
Pathways :
WP2272: Pathogenic Escherichia coli infection
WP2292: Chemokine signaling pathway
WP211: BMP signaling pathway
WP2032: TSH signaling pathway
WP2203: TSLP Signaling Pathway
WP723: Wnt Signaling Pathway and Pluripotency
WP1909: Signal regulatory protein (SIRP) family interactions
WP505: TGF Beta Signaling Pathway
WP560: TGF Beta Signaling Pathway
WP1288: Wnt Signaling Pathway and Pluripotency
WP1135: Wnt Signaling Pathway
WP930: TGF Beta Signaling Pathway
WP1010: Wnt Signaling Pathway and Pluripotency
WP1344: Wnt Signaling Pathway and Pluripotency
WP785: Wnt Signaling Pathway
WP1371: G Protein Signaling Pathways
WP812: TGF Beta Signaling Pathway
WP2324: AGE/RAGE pathway
WP2371: Parkinsons Disease Pathway
WP428: Wnt Signaling Pathway
WP375: Wnt Signaling Pathway NetPath
WP539: Wnt Signaling Pathway NetPath
WP35: G Protein Signaling Pathways
WP113: TGF Beta Signaling Pathway
WP899: Wnt Signaling Pathway

Related Genes :
[Ccn6 Wisp3] Cellular communication network factor 6 (CCN family member 6) (WNT1-inducible-signaling pathway protein 3) (WISP-3)
[cwn-1 wnt-1 K10B4.6] Protein Wnt-1
[RHOU ARHU CDC42L1 G28K WRCH1 SB128] Rho-related GTP-binding protein RhoU (CDC42-like GTPase 1) (GTP-binding protein-like 1) (Rho GTPase-like protein ARHU) (Ryu GTPase) (Wnt-1 responsive Cdc42 homolog 1) (WRCH-1)
[Rhou Arhu G28k Wrch1] Rho-related GTP-binding protein RhoU (Rho GTPase-like protein ARHU) (Wnt-1 responsive Cdc42 homolog 1) (WRCH-1)
[CCN3 IGFBP9 NOV NOVH] CCN family member 3 (Cellular communication network factor 3) (Insulin-like growth factor-binding protein 9) (IBP-9) (IGF-binding protein 9) (IGFBP-9) (Nephro blastoma-overexpressed gene protein homolog) (Protein NOV homolog) (NovH)
[Ccn3 Nov] CCN family member 3 (Cellular communication network factor 3) (Nephroblastoma-overexpressed gene protein homolog) (Protein NOV homolog) (NovH)
[CCN2 CTGF HCS24 IGFBP8] CCN family member 2 (Cellular communication network factor 2) (Connective tissue growth factor) (Hypertrophic chondrocyte-specific protein 24) (Insulin-like growth factor-binding protein 8) (IBP-8) (IGF-binding protein 8) (IGFBP-8)
[Ccn3 Nov] CCN family member 3 (Cellular communication network factor 3) (Nephroblastoma-overexpressed gene protein homolog) (Protein NOV homolog) (NovH)
[FERMT2 KIND2 MIG2 PLEKHC1] Fermitin family homolog 2 (Kindlin-2) (Mitogen-inducible gene 2 protein) (MIG-2) (Pleckstrin homology domain-containing family C member 1) (PH domain-containing family C member 1)
[WNT10B WNT12] Protein Wnt-10b (Protein Wnt-12)
[IFITM1 CD225 IFI17] Interferon-induced transmembrane protein 1 (Dispanin subfamily A member 2a) (DSPA2a) (Interferon-induced protein 17) (Interferon-inducible protein 9-27) (Leu-13 antigen) (CD antigen CD225)
[CCL4 LAG1 MIP1B SCYA4] C-C motif chemokine 4 (G-26 T-lymphocyte-secreted protein) (HC21) (Lymphocyte activation gene 1 protein) (LAG-1) (MIP-1-beta(1-69)) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (PAT 744) (Protein H400) (SIS-gamma) (Small-inducible cytokine A4) (T-cell activation protein 2) (ACT-2) [Cleaved into: MIP-1-beta(3-69)]
[Ifitm3] Interferon-induced transmembrane protein 3 (Dispanin subfamily A member 2b) (DSPA2b) (Fragilis protein) (Interferon-inducible protein 15) (Mouse ifitm-like protein 1) (Mil-1)
[SFRP1 FRP FRP1 SARP2] Secreted frizzled-related protein 1 (FRP-1) (sFRP-1) (Secreted apoptosis-related protein 2) (SARP-2)
[GPRC5B RAIG2] G-protein coupled receptor family C group 5 member B (A-69G12.1) (Retinoic acid-induced gene 2 protein) (RAIG-2)
[wnt5b wnt-5 wnt5 wnt5a si:ch73-211c7.1] Protein Wnt-5b
[TNFSF18 AITRL GITRL TL6 UNQ149/PRO175] Tumor necrosis factor ligand superfamily member 18 (Activation-inducible TNF-related ligand) (AITRL) (Glucocorticoid-induced TNF-related ligand) (hGITRL)
[Enpp1 Npps Pc1 Pdnp1] Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 (E-NPP 1) (Lymphocyte antigen 41) (Ly-41) (Phosphodiesterase I/nucleotide pyrophosphatase 1) (Plasma-cell membrane glycoprotein PC-1) [Cleaved into: Ectonucleotide pyrophosphatase/phosphodiesterase family member 1, secreted form] [Includes: Alkaline phosphodiesterase I (EC 3.1.4.1); Nucleotide pyrophosphatase (NPPase) (EC 3.6.1.9) (Nucleotide diphosphatase)]
[Ddit4 Dig2 Redd1 Rtp801] DNA damage-inducible transcript 4 protein (Dexamethasone-induced gene 2 protein) (HIF-1 responsive protein RTP801) (Protein regulated in development and DNA damage response 1) (REDD-1)
[ENPP1 M6S1 NPPS PC1 PDNP1] Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 (E-NPP 1) (Membrane component chromosome 6 surface marker 1) (Phosphodiesterase I/nucleotide pyrophosphatase 1) (Plasma-cell membrane glycoprotein PC-1) [Cleaved into: Ectonucleotide pyrophosphatase/phosphodiesterase family member 1, secreted form] [Includes: Alkaline phosphodiesterase I (EC 3.1.4.1); Nucleotide pyrophosphatase (NPPase) (EC 3.6.1.9) (Nucleotide diphosphatase)]
[cwn-2 wnt-2 W01B6.1] Protein Wnt-2
[WNT9B WNT14B WNT15 UNQ6973/PRO21956] Protein Wnt-9b (Protein Wnt-14b) (Protein Wnt-15)
[Wnt5a Wnt-5a] Protein Wnt-5a
[Sfrp1] Secreted frizzled-related protein 1 (sFRP-1)
[SFRP1 FRZA] Secreted frizzled-related protein 1 (sFRP-1) (Frizzled in aorta protein) (FrzA protein)
[WNT3A] Protein Wnt-3a
[Wnt5a Wnt-5a] Protein Wnt-5a
[WNT5A] Protein Wnt-5a
[Notch1 Motch] Neurogenic locus notch homolog protein 1 (Notch 1) (Motch A) (mT14) (p300) [Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD)]
[SOCS3 CIS3 SSI3] Suppressor of cytokine signaling 3 (SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (STAT-induced STAT inhibitor 3) (SSI-3)

Bibliography :