GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Wilms tumor protein homolog

 WT1_MOUSE               Reviewed;         449 AA.
P22561; A2A402;
01-AUG-1991, integrated into UniProtKB/Swiss-Prot.
01-AUG-1991, sequence version 1.
13-FEB-2019, entry version 174.
RecName: Full=Wilms tumor protein homolog;
Name=Wt1; Synonyms=Wt-1;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
PubMed=1671709; DOI=10.1128/MCB.11.3.1707;
Buckler A.J., Pelletier J., Haber D.A., Glaser T., Housman D.E.;
"Isolation, characterization, and expression of the murine Wilms'
tumor gene (WT1) during kidney development.";
Mol. Cell. Biol. 11:1707-1712(1991).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=C57BL/6J;
PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
Lindblad-Toh K., Eichler E.E., Ponting C.P.;
"Lineage-specific biology revealed by a finished genome assembly of
the mouse.";
PLoS Biol. 7:E1000112-E1000112(2009).
[3]
ALTERNATIVE INITIATION, AND ALTERNATIVE SPLICING (ISOFORMS 5 AND 6).
PubMed=8621495; DOI=10.1074/jbc.271.15.8646;
Bruening W., Pelletier J.;
"A non-AUG translational initiation event generates novel WT1
isoforms.";
J. Biol. Chem. 271:8646-8654(1996).
[4]
INTERACTION WITH U2AF2.
PubMed=9784496; DOI=10.1101/gad.12.20.3217;
Davies R.C., Calvio C., Bratt E., Larsson S.H., Lamond A.I.,
Hastie N.D.;
"WT1 interacts with the splicing factor U2AF65 in an isoform-dependent
manner and can be incorporated into spliceosomes.";
Genes Dev. 12:3217-3225(1998).
[5]
SUBCELLULAR LOCATION, RNA-BINDING, AND INTERACTION WITH POLYSOMES.
PubMed=14681305; DOI=10.1093/hmg/ddh040;
Niksic M., Slight J., Sanford J.R., Caceres J.F., Hastie N.D.;
"The Wilms' tumour protein (WT1) shuttles between nucleus and
cytoplasm and is present in functional polysomes.";
Hum. Mol. Genet. 13:463-471(2004).
[6]
INTERACTION WITH WTIP.
PubMed=14736876; DOI=10.1074/jbc.M314155200;
Srichai M.B., Konieczkowski M., Padiyar A., Konieczkowski D.J.,
Mukherjee A., Hayden P.S., Kamat S., El-Meanawy M.A., Khan S.,
Mundel P., Lee S.B., Bruggeman L.A., Schelling J.R., Sedor J.R.;
"A WT1 co-regulator controls podocyte phenotype by shuttling between
adhesion structures and nucleus.";
J. Biol. Chem. 279:14398-14408(2004).
[7]
FUNCTION.
PubMed=17167543; DOI=10.1139/o06-065;
Morrison A.A., Venables J.P., Dellaire G., Ladomery M.R.;
"The Wilms tumour suppressor protein WT1 (+KTS isoform) binds alpha-
actinin 1 mRNA via its zinc-finger domain.";
Biochem. Cell Biol. 84:789-798(2006).
[8]
FUNCTION, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=16467207; DOI=10.1182/blood-2005-07-2889;
Dame C., Kirschner K.M., Bartz K.V., Wallach T., Hussels C.S.,
Scholz H.;
"Wilms tumor suppressor, Wt1, is a transcriptional activator of the
erythropoietin gene.";
Blood 107:4282-4290(2006).
[9]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=16920711; DOI=10.1074/jbc.M602668200;
Kirschner K.M., Wagner N., Wagner K.-D., Wellmann S., Scholz H.;
"The Wilms tumor suppressor Wt1 promotes cell adhesion through
transcriptional activation of the alpha4integrin gene.";
J. Biol. Chem. 281:31930-31939(2006).
[10]
FUNCTION, INTERACTION WITH CITED2, AND DEVELOPMENTAL STAGE.
PubMed=17537799; DOI=10.1242/dev.004390;
Val P., Martinez-Barbera J.P., Swain A.;
"Adrenal development is initiated by Cited2 and Wt1 through modulation
of Sf-1 dosage.";
Development 134:2349-2358(2007).
[11]
INTERACTION WITH HNRNPU, AND SUBCELLULAR LOCATION.
PubMed=16924231; DOI=10.1038/sj.onc.1209922;
Spraggon L., Dudnakova T., Slight J., Lustig-Yariv O., Cotterell J.,
Hastie N., Miles C.;
"hnRNP-U directly interacts with WT1 and modulates WT1 transcriptional
activation.";
Oncogene 26:1484-1491(2007).
[12]
DEVELOPMENTAL STAGE.
PubMed=19457926; DOI=10.1093/hmg/ddp237;
Buaas F.W., Val P., Swain A.;
"The transcription co-factor CITED2 functions during sex determination
and early gonad development.";
Hum. Mol. Genet. 18:2989-3001(2009).
-!- FUNCTION: Transcription factor that plays an important role in
cellular development and cell survival (PubMed:16467207,
PubMed:16920711, PubMed:17537799). Recognizes and binds to the DNA
sequence 5'-GCG(T/G)GGGCG-3' (By similarity). Regulates the
expression of numerous target genes, including EPO
(PubMed:16467207). Plays an essential role for development of the
urogenital system. It has a tumor suppressor as well as an
oncogenic role in tumor formation. Function may be isoform-
specific: isoforms lacking the KTS motif may act as transcription
factors. Isoforms containing the KTS motif may bind mRNA and play
a role in mRNA metabolism or splicing (PubMed:17167543). Isoform 1
has lower affinity for DNA, and can bind RNA.
{ECO:0000250|UniProtKB:P19544, ECO:0000269|PubMed:16467207,
ECO:0000269|PubMed:16920711, ECO:0000269|PubMed:17167543,
ECO:0000269|PubMed:17537799}.
-!- SUBUNIT: Interacts with ZNF224 via the zinc-finger region.
Interacts with WTAP, AMER1 and SRY. Interacts with RBM4 (By
similarity). Homodimer. Interacts with WTIP. Interacts with
actively translating polysomes. Detected in nuclear
ribonucleoprotein (mRNP) particles. Interacts with U2AF2.
Interacts with HNRNPU via the zinc-finger region. Isoform 1 and
isoform 3 interacts with CITED2. {ECO:0000250,
ECO:0000269|PubMed:14681305, ECO:0000269|PubMed:14736876,
ECO:0000269|PubMed:16924231, ECO:0000269|PubMed:17537799,
ECO:0000269|PubMed:9784496}.
-!- SUBCELLULAR LOCATION: Isoform 1: Nucleus speckle.
-!- SUBCELLULAR LOCATION: Isoform 4: Nucleus, nucleoplasm.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:14681305}.
Nucleus, nucleolus {ECO:0000250}. Cytoplasm
{ECO:0000269|PubMed:14681305}. Nucleus speckle. Note=Shuttles
between nucleus and cytoplasm. {ECO:0000269|PubMed:14681305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing, Alternative initiation; Named isoforms=6;
Name=1;
IsoId=P22561-1; Sequence=Displayed;
Note=Detected in nucleus speckle, may bind mRNA.;
Name=2;
IsoId=P22561-2; Sequence=VSP_006868, VSP_006869;
Name=3;
IsoId=P22561-3; Sequence=VSP_006868;
Name=4;
IsoId=P22561-4; Sequence=VSP_006869;
Note=Detected in nucleoplasm, probably functions as
transcription factor.;
Name=5;
IsoId=P22561-5; Sequence=VSP_037585;
Note=Produced by alternative initiation of isoform 1. Extended
N-terminus.;
Name=6;
IsoId=P22561-6; Sequence=VSP_037585, VSP_006868;
Note=Produced by alternative initiation of isoform 1. Extended
N-terminus.;
-!- TISSUE SPECIFICITY: Detected in neurons of the embryonic dorsal
root ganglion and in Sertoli cells of the adult testis (at protein
level). Detected in kidney. {ECO:0000269|PubMed:16467207}.
-!- DEVELOPMENTAL STAGE: Expressed in the coelomic epithelium and
within some mesonephric tubules of the genital ridge at 10 dpc.
Expressed during kidney development. {ECO:0000269|PubMed:17537799,
ECO:0000269|PubMed:19457926}.
-!- DOMAIN: Binds to DNA motifs with the sequence 5'-GCG(T/G)GGGCG-3'
via its C2H2-type zinc fingers. Starting from the N-terminus, the
second zinc finger binds to the 3'-GCG motif, the middle zinc
finger interacts with the central TGG motif, and the C-terminal
zinc finger binds to the 5'-GCG motif. Binds double-stranded
target DNA, irrespective of the cytosine methylation status. Has
reduced affinity for target DNA where the cytosines have been
oxidized to 5-hydroxymethylcytosine, 5-formylcytosine or 5-
carboxylcytosine. {ECO:0000250|UniProtKB:P19544}.
-!- RNA EDITING: Modified_positions=281 {ECO:0000250}; Note=Partially
edited. {ECO:0000250};
-!- MISCELLANEOUS: Presence of the KTS motif hinders interactions
between DNA and zinc-finger 4. {ECO:0000250}.
-!- SIMILARITY: Belongs to the EGR C2H2-type zinc-finger protein
family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=Ref.3; Type=Miscellaneous discrepancy; Note=Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; M55512; AAA40573.1; -; mRNA.
EMBL; AL512584; CAM18169.2; -; Genomic_DNA.
CCDS; CCDS16496.2; -. [P22561-5]
PIR; A39692; A39692.
UniGene; Mm.389339; -.
ProteinModelPortal; P22561; -.
SMR; P22561; -.
IntAct; P22561; 1.
MINT; P22561; -.
STRING; 10090.ENSMUSP00000117891; -.
PhosphoSitePlus; P22561; -.
PaxDb; P22561; -.
PRIDE; P22561; -.
DNASU; 22431; -.
MGI; MGI:98968; Wt1.
eggNOG; KOG1721; Eukaryota.
eggNOG; COG5048; LUCA.
HOGENOM; HOG000230937; -.
HOVERGEN; HBG006960; -.
InParanoid; P22561; -.
OrthoDB; 1318335at2759; -.
PhylomeDB; P22561; -.
PRO; PR:P22561; -.
Proteomes; UP000000589; Unplaced.
GO; GO:0005737; C:cytoplasm; IDA:MGI.
GO; GO:0005829; C:cytosol; ISO:MGI.
GO; GO:0016607; C:nuclear speck; ISS:UniProtKB.
GO; GO:0005730; C:nucleolus; IEA:UniProtKB-SubCell.
GO; GO:0005654; C:nucleoplasm; ISS:UniProtKB.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0070742; F:C2H2 zinc finger domain binding; ISS:UniProtKB.
GO; GO:0001228; F:DNA-binding transcription activator activity, RNA polymerase II-specific; IDA:UniProtKB.
GO; GO:0003700; F:DNA-binding transcription factor activity; IDA:UniProtKB.
GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; IBA:GO_Central.
GO; GO:0003690; F:double-stranded DNA binding; IDA:MGI.
GO; GO:0010385; F:double-stranded methylated DNA binding; ISS:UniProtKB.
GO; GO:0044729; F:hemi-methylated DNA-binding; ISS:UniProtKB.
GO; GO:0003723; F:RNA binding; IDA:MGI.
GO; GO:0043565; F:sequence-specific DNA binding; ISS:UniProtKB.
GO; GO:0044212; F:transcription regulatory region DNA binding; ISS:UniProtKB.
GO; GO:0008270; F:zinc ion binding; ISS:UniProtKB.
GO; GO:0035802; P:adrenal cortex formation; IMP:UniProtKB.
GO; GO:0030325; P:adrenal gland development; IMP:UniProtKB.
GO; GO:0006915; P:apoptotic process; IMP:MGI.
GO; GO:0001658; P:branching involved in ureteric bud morphogenesis; IMP:UniProtKB.
GO; GO:0043010; P:camera-type eye development; IMP:MGI.
GO; GO:0060923; P:cardiac muscle cell fate commitment; IMP:BHF-UCL.
GO; GO:0071320; P:cellular response to cAMP; IBA:GO_Central.
GO; GO:0071371; P:cellular response to gonadotropin stimulus; ISS:UniProtKB.
GO; GO:0060976; P:coronary vasculature development; TAS:DFLAT.
GO; GO:0060539; P:diaphragm development; IMP:UniProtKB.
GO; GO:0030855; P:epithelial cell differentiation; IMP:UniProtKB.
GO; GO:0030317; P:flagellated sperm motility; IMP:MGI.
GO; GO:0007281; P:germ cell development; IMP:MGI.
GO; GO:0032836; P:glomerular basement membrane development; ISO:MGI.
GO; GO:0072015; P:glomerular visceral epithelial cell development; IEP:UniProtKB.
GO; GO:0072112; P:glomerular visceral epithelial cell differentiation; IDA:UniProtKB.
GO; GO:0032835; P:glomerulus development; IMP:UniProtKB.
GO; GO:0008406; P:gonad development; IMP:UniProtKB.
GO; GO:0007507; P:heart development; IMP:UniProtKB.
GO; GO:0001822; P:kidney development; IMP:UniProtKB.
GO; GO:0030539; P:male genitalia development; IMP:UniProtKB.
GO; GO:0008584; P:male gonad development; IMP:MGI.
GO; GO:0060231; P:mesenchymal to epithelial transition; IMP:UniProtKB.
GO; GO:0001823; P:mesonephros development; IMP:MGI.
GO; GO:0072278; P:metanephric comma-shaped body morphogenesis; IEP:UniProtKB.
GO; GO:0072075; P:metanephric mesenchyme development; IMP:UniProtKB.
GO; GO:0072284; P:metanephric S-shaped body morphogenesis; IMP:UniProtKB.
GO; GO:0001656; P:metanephros development; IMP:UniProtKB.
GO; GO:0043066; P:negative regulation of apoptotic process; IMP:UniProtKB.
GO; GO:0030308; P:negative regulation of cell growth; ISS:UniProtKB.
GO; GO:0008285; P:negative regulation of cell population proliferation; ISO:MGI.
GO; GO:2000195; P:negative regulation of female gonad development; IMP:UniProtKB.
GO; GO:1900212; P:negative regulation of mesenchymal cell apoptotic process involved in metanephros development; IMP:MGI.
GO; GO:0072302; P:negative regulation of metanephric glomerular mesangial cell proliferation; IMP:UniProtKB.
GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; ISO:MGI.
GO; GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:UniProtKB.
GO; GO:0017148; P:negative regulation of translation; ISS:UniProtKB.
GO; GO:0043065; P:positive regulation of apoptotic process; ISS:UniProtKB.
GO; GO:1905643; P:positive regulation of DNA methylation; ISO:MGI.
GO; GO:0010628; P:positive regulation of gene expression; ISO:MGI.
GO; GO:0060421; P:positive regulation of heart growth; IMP:UniProtKB.
GO; GO:2000020; P:positive regulation of male gonad development; IMP:UniProtKB.
GO; GO:2001076; P:positive regulation of metanephric ureteric bud development; IMP:UniProtKB.
GO; GO:1902895; P:positive regulation of pri-miRNA transcription by RNA polymerase II; ISO:MGI.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IDA:MGI.
GO; GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:UniProtKB.
GO; GO:0072166; P:posterior mesonephric tubule development; IMP:UniProtKB.
GO; GO:0003156; P:regulation of animal organ formation; IMP:UniProtKB.
GO; GO:0010468; P:regulation of gene expression; IMP:MGI.
GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IDA:MGI.
GO; GO:0006355; P:regulation of transcription, DNA-templated; IDA:MGI.
GO; GO:0008380; P:RNA splicing; IDA:UniProtKB.
GO; GO:0072520; P:seminiferous tubule development; IMP:MGI.
GO; GO:0060009; P:Sertoli cell development; IMP:MGI.
GO; GO:0007530; P:sex determination; IMP:MGI.
GO; GO:0007338; P:single fertilization; IMP:MGI.
GO; GO:0007283; P:spermatogenesis; IMP:MGI.
GO; GO:0007356; P:thorax and anterior abdomen determination; IMP:UniProtKB.
GO; GO:0009888; P:tissue development; IMP:MGI.
GO; GO:0001657; P:ureteric bud development; IMP:UniProtKB.
GO; GO:0001570; P:vasculogenesis; IMP:MGI.
GO; GO:0061032; P:visceral serous pericardium development; IMP:UniProtKB.
InterPro; IPR017987; Wilms_tumour.
InterPro; IPR000976; Wilms_tumour_N.
InterPro; IPR036236; Znf_C2H2_sf.
InterPro; IPR013087; Znf_C2H2_type.
PANTHER; PTHR44601; PTHR44601; 1.
Pfam; PF02165; WT1; 2.
Pfam; PF00096; zf-C2H2; 2.
SMART; SM00355; ZnF_C2H2; 4.
SUPFAM; SSF57667; SSF57667; 2.
PROSITE; PS00028; ZINC_FINGER_C2H2_1; 4.
PROSITE; PS50157; ZINC_FINGER_C2H2_2; 4.
1: Evidence at protein level;
Alternative initiation; Alternative splicing; Complete proteome;
Cytoplasm; DNA-binding; Isopeptide bond; Metal-binding; Nucleus;
Reference proteome; Repeat; RNA editing; RNA-binding; Transcription;
Transcription regulation; Tumor suppressor; Ubl conjugation; Zinc;
Zinc-finger.
CHAIN 1 449 Wilms tumor protein homolog.
/FTId=PRO_0000047132.
ZN_FING 323 347 C2H2-type 1. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 353 377 C2H2-type 2. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 383 405 C2H2-type 3. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 414 438 C2H2-type 4. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
REGION 367 381 Important for interaction with target
DNA. {ECO:0000250}.
REGION 393 401 Important for interaction with target
DNA. {ECO:0000250}.
MOTIF 408 410 KTS motif. {ECO:0000250}.
COMPBIAS 28 83 Pro-rich.
SITE 424 424 Important for interaction with target
DNA. {ECO:0000250}.
SITE 430 430 Important for interaction with target
DNA. {ECO:0000250}.
CROSSLNK 73 73 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO).
{ECO:0000250}.
CROSSLNK 177 177 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO).
{ECO:0000250}.
CROSSLNK 444 444 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:P19544}.
VAR_SEQ 1 1 M -> MDFLLSQEPASTCVPEPASQHTLRREPGCVQQPEQP
GDRGPRSAWAKSSAENPQDRRSGEPSASEPHLM (in
isoform 5 and isoform 6). {ECO:0000305}.
/FTId=VSP_037585.
VAR_SEQ 250 266 Missing (in isoform 2, isoform 3 and
isoform 6). {ECO:0000303|PubMed:1671709}.
/FTId=VSP_006868.
VAR_SEQ 408 410 Missing (in isoform 2 and isoform 4).
{ECO:0000303|PubMed:1671709}.
/FTId=VSP_006869.
VARIANT 281 281 L -> P (in RNA edited version).
CONFLICT 33 33 R -> A (in Ref. 2; CAM18169).
{ECO:0000305}.
CONFLICT 269 269 I -> T (in Ref. 2; CAM18169).
{ECO:0000305}.
CONFLICT 446 447 HV -> QL (in Ref. 2; CAM18169).
{ECO:0000305}.
SEQUENCE 449 AA; 49246 MW; 962381E9C8D7A380 CRC64;
MGSDVRDLNA LLPAVSSLGG GGGGCGLPVS GARQWAPVLD FAPPGASAYG SLGGPAPPPA
PPPPPPPPHS FIKQEPSWGG AEPHEEQCLS AFTLHFSGQF TGTAGACRYG PFGPPPPSQA
SSGQARMFPN APYLPSCLES QPTIRNQGYS TVTFDGAPSY GHTPSHHAAQ FPNHSFKHED
PMGQQGSLGE QQYSVPPPVY GCHTPTDSCT GSQALLLRTP YSSDNLYQMT SQLECMTWNQ
MNLGATLKGM AAGSSSSVKW TEGQSNHGIG YESENHTAPI LCGAQYRIHT HGVFRGIQDV
RRVSGVAPTL VRSASETSEK RPFMCAYPGC NKRYFKLSHL QMHSRKHTGE KPYQCDFKDC
ERRFSRSDQL KRHQRRHTGV KPFQCKTCQR KFSRSDHLKT HTRTHTGKTS EKPFSCRWHS
CQKKFARSDE LVRHHNMHQR NMTKLHVAL


Related products :

Catalog number Product name Quantity
EIAAB46373 Homo sapiens,Human,Putative Wilms tumor upstream neighbor 1 gene protein,Wilms tumor-associated antisense RNA,WIT1,WIT-1,WT1-AS
EIAAB46468 Pig,Sus scrofa,Wilms tumor protein homolog,WT1
EIAAB46466 Rat,Rattus norvegicus,Wilms tumor protein homolog,Wt1,Wt-1
EIAAB46467 Mouse,Mus musculus,Wilms tumor protein homolog,Wt1,Wt-1
WT1_RAT ELISA Kit FOR Wilms tumor protein homolog; organism: Rat; gene name: Wt1 96T
10-288-22286F Wilms' tumor 1-associating protein - WT1-associated protein; Putative pre-mRNA-splicing regulator female-lethal(2D) homolog 0.1 mg
10-288-22286F Wilms' tumor 1-associating protein - WT1-associated protein; Putative pre-mRNA-splicing regulator female-lethal(2D) homolog 0.05 mg
15-288-22286F Wilms' tumor 1-associating protein - WT1-associated protein; Putative pre-mRNA-splicing regulator female-lethal(2D) homolog Polyclonal 0.1 mg
15-288-22286F Wilms' tumor 1-associating protein - WT1-associated protein; Putative pre-mRNA-splicing regulator female-lethal(2D) homolog Polyclonal 0.05 mg
LF-PA41269 anti-Wilms Tumor 1 (WT1) , Rabbit polyclonal to Wilms Tumor 1 (WT1) , Isotype IgG, Host Rabbit 50 ug
Mob 437-05 Wilms Tumor 1 Protein (WT1); 0.5ml
AP15857PU-N WT1 _ Wilms tumor protein 1.0 ml
GTX15250 WT1 _ Wilms tumor protein 7 ml
AM00403SU-N WT1 _ Wilms tumor protein 0.5 ml
GTX15249 WT1 _ Wilms tumor protein 500 µl
AP00615PU-N WT1 _ Wilms tumor protein 0.1 mg
GTX15250 WT1 _ Wilms tumor protein 7 ml
GTX15249 WT1 _ Wilms tumor protein 500 µl
GTX114163 WT1 _ Wilms tumor protein 0.1 ml
AP07246PU-N WT1 _ Wilms tumor protein 50 µg
GTX100563 WT1 _ Wilms tumor protein 100 µl
AP15857PU-N WT1 _ Wilms tumor protein 1.0 ml
AP07246PU-N WT1 _ Wilms tumor protein 50 µg
ARP37989_P050 WT1 _ Wilms tumor protein 50 µg
GTX30735 WT1 _ Wilms tumor protein 0.5 ml

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1663: Homologous recombination
WP1676: Non-homologous end-joining
WP1036: Homologous recombination
WP1049: G Protein Signaling Pathways
WP1097: Non-homologous end joining
WP1153: Homologous recombination
WP1165: G Protein Signaling Pathways
WP1201: Non-homologous end joining
WP1205: Homologous recombination
WP1208: Non-homologous end joining
WP1216: Homologous recombination
WP1222: Non-homologous end joining
WP1234: Homologous recombination
WP1242: Non-homologous end joining
WP1258: Homologous recombination
WP1277: Non-homologous end joining
WP1296: Homologous recombination
WP1324: Non-homologous end joining
WP1362: Homologous recombination
WP1371: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1493: Carbon assimilation C4 pathway
WP1502: Mitochondrial biogenesis
WP1531: Vitamin D synthesis
WP1566: Citrate cycle (TCA cycle)

Related Genes :
[Wt1 Wt-1] Wilms tumor protein homolog
[Wt1 Wt-1] Wilms tumor protein homolog
[WT1] Wilms tumor protein homolog
[wt1-a wt1] Wilms tumor protein homolog A (XWT1a) (xWT1)
[WT1] Wilms tumor protein homolog (Fragment)
[WT1] Wilms tumor protein homolog (Fragment)
[WTAP KIAA0105] Pre-mRNA-splicing regulator WTAP (Female-lethal(2)D homolog) (hFL(2)D) (WT1-associated protein) (Wilms tumor 1-associating protein)
[WT1] Wilms tumor protein (WT33)
[Wtap] Pre-mRNA-splicing regulator WTAP (Female-lethal(2)D homolog) (WT1-associated protein) (Wilms tumor 1-associating protein)
[wtip si:ch211-79l17.3] Wilms tumor protein 1-interacting protein homolog (WT1-interacting protein homolog)
[AMER1 FAM123B WTX] APC membrane recruitment protein 1 (Amer1) (Protein FAM123B) (Wilms tumor gene on the X chromosome protein)
[wt1-b wt1] Wilms tumor protein homolog B (XWT1b) (XeWT1)
[wt1] Wilms tumor protein homolog
[Wtip] Wilms tumor protein 1-interacting protein (WT1-interacting protein)
[Mtus1 Atbp Atip Cctsg1 Kiaa1288 Mtsg1] Microtubule-associated tumor suppressor 1 homolog (AT2 receptor-binding protein) (Angiotensin-II type 2 receptor-interacting protein) (Coiled-coiled tumor suppressor gene 1 protein) (Mitochondrial tumor suppressor 1 homolog)
[TWT1] Wilms tumor 1 protein
[WTIP] Wilms tumor protein 1-interacting protein (WT1-interacting protein)
[RPL10 DXS648E QM] 60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM)
[WT1 +KTS isoform] Wilms tumor 1 +KTS isoform
[WT1 -KTS isoform] Wilms tumor 1-KTS isoform
[LATS1 WARTS] Serine/threonine-protein kinase LATS1 (EC 2.7.11.1) (Large tumor suppressor homolog 1) (WARTS protein kinase) (h-warts)
[Lats2] Serine/threonine-protein kinase LATS2 (EC 2.7.11.1) (Kinase phosphorylated during mitosis protein) (Large tumor suppressor homolog 2) (Serine/threonine-protein kinase kpm)
[Litaf N4wbp3 Tbx1] Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog (LPS-induced TNF-alpha factor homolog) (Estrogen-enhanced transcript protein) (mEET) (LITAF-like protein) (NEDD4 WW domain-binding protein 3)
[LATS2 KPM] Serine/threonine-protein kinase LATS2 (EC 2.7.11.1) (Kinase phosphorylated during mitosis protein) (Large tumor suppressor homolog 2) (Serine/threonine-protein kinase kpm) (Warts-like kinase)
[TP63 KET P63 P73H P73L TP73L] Tumor protein 63 (p63) (Chronic ulcerative stomatitis protein) (CUSP) (Keratinocyte transcription factor KET) (Transformation-related protein 63) (TP63) (Tumor protein p73-like) (p73L) (p40) (p51)
[TP53 P53] Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)
[CHEK2 CDS1 CHK2 RAD53] Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2)
[Lats1 Warts] Serine/threonine-protein kinase LATS1 (EC 2.7.11.1) (Large tumor suppressor homolog 1) (WARTS protein kinase)
[L3MBTL1 KIAA0681 L3MBT L3MBTL] Lethal(3)malignant brain tumor-like protein 1 (H-l(3)mbt) (H-l(3)mbt protein) (L(3)mbt-like) (L(3)mbt protein homolog) (L3MBTL1)
[LTBR D12S370 TNFCR TNFR3 TNFRSF3] Tumor necrosis factor receptor superfamily member 3 (Lymphotoxin-beta receptor) (Tumor necrosis factor C receptor) (Tumor necrosis factor receptor 2-related protein) (Tumor necrosis factor receptor type III) (TNF-RIII) (TNFR-III)

Bibliography :
[29790264] Immune responses against tumour-associated antigen-derived cytotoxic T lymphocyte epitopes in cholangiocarcinoma patients.
[29357419] Modulation of apolipoprotein L1-microRNA-193a axis prevents podocyte dedifferentiation in high-glucose milieu.
[28668862] Clinicopathological Characteristics of Metaplastic Papillary Tumor of the Fallopian Tube.
[28529243] Over-Expression of miR-21 and Lower PTEN Levels in Wilms' Tumor with Aggressive Behavior.
[28301057] The correlation between LIN28B gene potentially functional variants and Wilms tumor susceptibility in Chinese children.
[27103452] RNA epigenetic modification: N6-methyladenosine.
[26848979] Aberrant epigenetic regulation in clear cell sarcoma of the kidney featuring distinct DNA hypermethylation and EZH2 overexpression.
[26729549] Gastrointestinal Findings in the Largest Series of Patients With Hereditary Biallelic Mismatch Repair Deficiency Syndrome: Report from the International Consortium.
[26655220] Wilms Tumor Suppressor, WT1, Cooperates with MicroRNA-26a and MicroRNA-101 to Suppress Translation of the Polycomb Protein, EZH2, in Mesenchymal Stem Cells.
[26155408] Trial watch: Naked and vectored DNA-based anticancer vaccines.
?>