Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Related Genes to Tap1

[TAP1 ABCB2 PSF1 RING4 Y3] Antigen peptide transporter 1 (APT1) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein)

[Tap1 Abcb2 Ham-1 Ham1] Antigen peptide transporter 1 (APT1) (ATP-binding cassette sub-family B member 2) (Histocompatibility antigen modifier 1) (Peptide transporter TAP1)

[Tap1 Abcb2 Mtp1] Antigen peptide transporter 1 (APT1) (ATP-binding cassette sub-family B member 2) (Peptide transporter TAP1)

[RAT1 HKE1 TAP1 YOR048C] 5'-3' exoribonuclease 2 (EC 3.1.13.-) (Ribonucleic acid-trafficking protein 1) (p116)

[Tk CG14734] Tachykinins (dTk) [Cleaved into: Tachykinin-related peptide 1 (TK-1) (dTK-1) (APTSSFIGMR-amide); Tachykinin-associated peptide 1 (TAP1) (DEEHDTSEGNWLGSGPDPLDYADEEADSSYAEN-amide); Tachykinin-related peptide 2 (TK-2) (dTK-2) (APLAFVGLR-amide); Tachykinin-associated peptide 2 (TAP2) (FIPINNRLSDVLQSLEEERLRDSLLQDFFDRVAGRDGSAV-amide); Tachykinin-related peptide 3 (TK-3) (dTK-3) (APTGFTGMR-amide); Tachykinin-associated peptide 3 (TAP3) (Brain peptide PALLAGDDDAEADEATELQQ); Tachykinin-related peptide 4 (TK-4) (dTK-4) (APVNSFVGMR-amide); Tachykinin-associated peptide 4 (TAP4) (Brain peptide DVSHQHY); Tachykinin-associated peptide 5 (TAP5) (AALSDSYDLRGKQQRFADFNSKFVAVR-amide); Tachykinin-associated peptide 6 (TAP6) (Brain peptide SDLEGNGVGIGDDHEQALVHPWLYLWGE); Tachykinin-related peptide 5 (TK-5) (dTK-5) (APNGFLGMR-amide)]

[TAP1 GLYMA_18G216900] Histone acetyltransferase TAP1 (GmTAP1) (EC 2.3.1.48)

[TAP1] Antigen peptide transporter 1 (APT1) (ATP-binding cassette sub-family B member 2) (Peptide transporter TAP1)

[tap-1 C44H4.5] TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (TAB1-like protein 1) (TAK1 kinase/MOM-4 binding Protein)

[TRPC4AP C20orf188 TRRP4AP] Short transient receptor potential channel 4-associated protein (Trp4-associated protein) (Trpc4-associated protein) (Protein TAP1) (TNF-receptor ubiquitous scaffolding/signaling protein) (Protein TRUSS)

[Tap1 Arrb2-ps Hla-dma Hla-dmb Psmb9 RT1-Ba RT1-Bb RT1-Da RT1-Db1 RT1-Db2 RT1-DOb tap1 Tap2 Tesb rCG_61064] Antigen peptide transporter 1 (Tap1 protein) (Transporter 1, ATP-binding cassette, sub-family B (MDR/TAP))

[TAT1 TAP1 VAP1 YBR069C YBR0710] Valine/tyrosine/tryptophan amino-acid permease 1 (Tyrosine and tryptophan amino acid transporter 1)

[ABCB26 TAP1 At1g70610 F24J13.18 F5A18.21] ABC transporter B family member 26, chloroplastic (ABC transporter ABCB.26) (AtABCB26) (Antigen peptide transporter-like 1) (Transporter associated with antigen processing-like protein 1) (AtTAP1)

[TAP1] Suberization-associated anionic peroxidase 1 (EC 1.11.1.7) (TMP1)

[Trpc4ap Trrp4ap] Short transient receptor potential channel 4-associated protein (Trp4-associated protein) (Trpc4-associated protein) (Protein TAP1) (Rabex-5/Rin2-interacting protein) (TNF-receptor ubiquitous scaffolding/signaling protein) (Protein TRUSS)

[TAP1] Transporter 1, ATP binding cassette subfamily B member

[COI] Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment)

[COI] Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Fragment)

[Tk GA13208] Tachykinins [Cleaved into: Tachykinin-related peptide 1 (TK-1) (APTSSFIGMR-amide); Tachykinin-associated peptide 1 (TAP1) (EDEKDQRAADWMGPDPLDYADMDEDSIYYEN-amide); Tachykinin-related peptide 2 (TK-2) (APMSFVGMR-amide); Tachykinin-associated peptide 2 (TAP2) (YIPISNRLSDVLHQIEEQRMRENLLEDLFERLAAGDDSVGDV-amide); Tachykinin-related peptide 3 (TK-3) (APTGFTGMR-amide); Tachykinin-associated peptide 3 (TAP3) (Brain peptide PMSGDDDDNDAMELLQ); Tachykinin-related peptide 4 (TK-4) (APVNSFLGVR-amide); Tachykinin-associated peptide 4 (TAP4) (Brain peptide DVSHQHY); Tachykinin-associated peptide 5 (TAP5) (AALSEAYDVRGKKERYADFNSKFVAVR-amide); Tachykinin-associated peptide 6 (TAP6) (Brain peptide SEQEAGLDTGDGDGDQQYLVRPWLYLWADN); Tachykinin-related peptide 5 (TK-5) (APSGFQGMR-amide)]

[TAP1 SBAB-554F3.5-003] Antigen peptide transporter 1 (Transporter 1, ATP-binding cassette, sub-family B (MDR/TAP))

[TAP1] TAP1 (Fragment)

[RT1-Da Arrb2-ps DA1 H2-Ea Hla-dma Hla-dmb Psmb9 RT1-Ba RT1-Bb RT1-Db1 RT1-Db2 RT1-DOb Tap1 Tap2 Tesb rCG_60548] Histocompatibility 2, class II antigen E alpha (RCG60548) (RT1 class II, D alpha) (RT1 class II, locus Da) (RT1-Da)

[TAP1] Transporter 1, ATP binding cassette subfamily B member

[Psmb9 Arrb2-ps Hla-dma Hla-dmb RT1-Ba RT1-Bb RT1-Da RT1-Db1 RT1-Db2 RT1-DOb Tap1 Tap2 Tesb rCG_60725] Proteasome subunit beta (EC 3.4.25.1)

[TAP1] TAP1 (Transporter 1 ATP-binding cassette sub-family B isoform 1) (Fragment)

[TAP1 CR201_G0016208] TAP1 isoform 1

[TAP1] Uncharacterized protein

[RT1-Ba Arrb2-ps BA1 Hla-dma Hla-dmb Psmb9 RT1-Bb RT1-Da RT1-Db1 RT1-Db2 RT1-DOb Tap1 Tap2 Tesb rCG_60724] MHC class II antigen (RCG60724, isoform CRA_a) (RT1 class II, B alpha) (RT1 class II, locus Ba) (RT1-Ba) (Rano class II histocompatibility antigen, B alpha chain)

[TAP1] Uncharacterized protein

[tap1 abcb2] Transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)

[TAP1] Uncharacterized protein

 

Gentaur Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
[email protected] | Gentaur





Gentaur Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
[email protected] | Gentaur

 

 




Gentaur France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

[email protected] | Gentaur

Gentaur GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
[email protected] | Gentaur

Gentaur U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
[email protected]

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




Gentaur Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
[email protected] | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






Gentaur Spain
tel:0911876558
[email protected] | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: [email protected] | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

Gentaur Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

[email protected] | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

Gentaur Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
[email protected] | Gentaur