GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Index / BPS Bioscience / Cytokine VEGF165 /Product Detail : 91001-1 Cytokine VEGF165
Related keywords:

#91001-1

Cytokine VEGF165

 Price: 262   EUR
297   USD
203   GBP

Product name : Cytokine VEGF165

Catalog number : 91001-1

Quantity: 10 µg

Availability: Yes

Supplier name : BPS Bioscience

Data sheet Data sheet : Ask more or other datasheet now !

More Details about

Description: Recombinant human VEGF165 (GenBank Accession No. NM_001025368) is a 38.2
kDa disulfide-linked homodimeric protein (a.a. 207-371), consisting of two 165 amino acid
polypeptide.

Source: E.coli

Stability: The lyophilized protein is stable for at least 2 years from date of receipt at -20°C.

Purity: >98% by SDS-PAGE and HPLC analysis.

Endotoxin Level: < 1EU per µg of VEGF as determined by the LAL method.

Biological Activity: ED50 is less than 3 ng/ml as determined by the dose-dependent stimulation
of the proliferation of human umbilical vein endothelial cells (HUVEC).

STORAGE/HANDLING:
The lyophilized powder, though stable at room temperature, is best
stored at -20°C. After a quick spin, reconstitute with sterile 4 mM
HCl to a concentration of 0.1-1.0 mg/mL. This solution can be
diluted into water or other buffered solutions and stored at 4°C for
one week or at -20°C for future use. Reconstituted human VEGF
should be stored in undiluted aliquots at -20°C for up to six months.

AA SEQUENCE:
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPD
EIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKP
HQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKH
LFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

References:
1. VEGF serum levels are not associated with Parkinson's disease Eur. J. Neurol. 14 (8), E6
(2007)
2. Association between vascular endothelial growth factor gene polymorphisms and
survival in hepatocellular carcinoma patients Hepatology 46 (2), 446-455 (2007)

Contact us about this product :

Our team will respond you as soon as possible !

Email:
Name:
Phone:
Question, Comment :